DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr98c and Gr43a

DIOPT Version :9

Sequence 1:NP_524531.2 Gene:Gr98c / 117336 FlyBaseID:FBgn0046886 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001286158.1 Gene:Gr43a / 35655 FlyBaseID:FBgn0041243 Length:453 Species:Drosophila melanogaster


Alignment Length:336 Identity:66/336 - (19%)
Similarity:120/336 - (35%) Gaps:116/336 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 MGRTQKFLIVAIATCNQLNILLNYGRLGLIYDEIANLDLGIDKSSKNFCGKSHWWSFRLRLTLSI 151
            :||:..|.:.: ||...:.:.|.|  .||::|  ||.::.:..            |||::...| 
  Fly    34 IGRSWLFTVYS-ATLTVVMVFLTY--RGLLFD--ANSEIPVRA------------SFRMKSATS- 80

  Fly   152 GLWMVIIIGVIPRLTLGRAGPFFHWVNQVLTQI---ILIMLQLKGPEYCLFVLLVYELILRTRHV 213
                                       :|:|.:   :::|..:.| .||....|...|.|..|  
  Fly    81 ---------------------------KVVTALDVSVVVMAIVSG-VYCGLFSLNDTLELNDR-- 115

  Fly   214 LEQLKDDLEDF-----DCGARIQELCVTLKQNQLLIGRIWRLVDEIGAYFR-------------- 259
            |.::.:.|..:     |....:....|:|....:|:|.      ::|.:.|              
  Fly   116 LNKIDNTLNAYNNFRRDRWRALGMAAVSLLAISILVGL------DVGTWMRIAQDMNIAQSDTEL 174

  Fly   260 ---WSM---TLLFLYNGLTILHVVN--WAIIRSIDPNDCCQLNRLGSITFLSFNLLLTCFFSECC 316
               |.:   :|.|:..||.: ::.|  :.:.|...     :|||:.|.:||:.| ..|.......
  Fly   175 NVHWYIPFYSLYFILTGLQV-NIANTAYGLGRRFG-----RLNRMLSSSFLAEN-NATSAIKPQK 232

  Fly   317 VKTYNSISYILHQIGCLPTAEEFQMLKM--------------GLKEYILQMQHLKLLFTCGGLFD 367
            |.|..::|.   ....:|:|....:.|:              ..:..||.::.|||     |.|.
  Fly   233 VSTVKNVSV---NRPAMPSALHASLTKLNGETLPSEAAGDKAAARSLILNVELLKL-----GYFP 289

  Fly   368 INIKLFGGMLV 378
            ...|   |:|:
  Fly   290 AKNK---GLLL 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr98cNP_524531.2 7tm_7 15..393 CDD:285581 66/336 (20%)
Gr43aNP_001286158.1 7tm_7 10..449 CDD:285581 66/336 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.