DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr98c and Gr8a

DIOPT Version :9

Sequence 1:NP_524531.2 Gene:Gr98c / 117336 FlyBaseID:FBgn0046886 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_511097.3 Gene:Gr8a / 31865 FlyBaseID:FBgn0030108 Length:385 Species:Drosophila melanogaster


Alignment Length:450 Identity:90/450 - (20%)
Similarity:148/450 - (32%) Gaps:136/450 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 MEAKRSRLLTTARPYLQVLSLFGLTPPAEFFTRTLRKRRRFCWMAGYSLYLIAILLMVFYEFHAN 67
            |.....|:|.......|||...||..|.:  ....|.|||   :..:||:|              
  Fly     1 MSGHLGRVLQFHLRLYQVLGFHGLPLPGD--GNPARTRRR---LMAWSLFL-------------- 46

  Fly    68 IVSLHLEIYK--FHVEDFSKVMGRTQKFLIVAIATCNQLNILLNYGRLGLIYDEIANLDLGIDKS 130
            ::||...:..  |..|:|   :.|...|      .|  .|..|.|     ::.|:..|.:.::..
  Fly    47 LISLSALVLACLFSGEEF---LYRGDMF------GC--ANDALKY-----VFAELGVLAIYLETL 95

  Fly   131 SKNFCGKSHWW-----------------SFRLRLTLSIGLWMVIIIGVIPRLTLGRAGPFFHWVN 178
            |......:.||                 .|:......|.|:.::...|...|.|        |..
  Fly    96 SSQRHLANFWWLHFKLGGQKTGLVSLRSEFQQFCRYLIFLYAMMAAEVAIHLGL--------WQF 152

  Fly   179 QVLTQIILIMLQLKGPEYCLFVLLVYELILRTRHVLEQLKDDLEDFDCGARIQELCVTLKQNQLL 243
            |.|||.:|:......|...|..|...:.:|.    ||.|::.|             ..|::...|
  Fly   153 QALTQHMLLFWSTYEPLVWLTYLRNLQFVLH----LELLREQL-------------TGLEREMGL 200

  Fly   244 IGRIWRLVDEIGAYFRWSMTLL------------------------FLYNGLTILHVVN------ 278
            :....|...|.|..|....:.|                        |.::.|.:|..:|      
  Fly   201 LAEYSRFASETGRSFPGFESFLRRRLVQKQRIYSHVYDMLKCFQGAFNFSILAVLLTINIRIAVD 265

  Fly   279 -----WAIIRSIDPNDCCQLNRLGSITFLSFNLLLT----CFFSECCVKTYNSISYILHQI---- 330
                 ::|..::..||          .:|....||.    .:.|:.|:.....|::.||.|    
  Fly   266 CYFMYYSIYNNVINND----------YYLIVPALLEIPAFIYASQSCMVVVPRIAHQLHNIVTDS 320

  Fly   331 GCLPTAEEFQMLKMGLKEYILQMQHLKLLFTCGGLFDINIKLFGGMLVTLCGYVIIIVQF 390
            ||....:    |.:.::.:.||:.|..:...|.||..::..|...|..::..|:|..:||
  Fly   321 GCCSCPD----LSLQIQNFSLQLLHQPIRIDCLGLTILDCSLLTRMACSVGTYMIYSIQF 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr98cNP_524531.2 7tm_7 15..393 CDD:285581 86/437 (20%)
Gr8aNP_511097.3 7tm_7 9..376 CDD:285581 86/440 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.