DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr98c and lite-1

DIOPT Version :9

Sequence 1:NP_524531.2 Gene:Gr98c / 117336 FlyBaseID:FBgn0046886 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_509043.3 Gene:lite-1 / 180894 WormBaseID:WBGene00001803 Length:439 Species:Caenorhabditis elegans


Alignment Length:181 Identity:40/181 - (22%)
Similarity:66/181 - (36%) Gaps:73/181 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   259 RWSM---TLLFLYNGLTILHVVNWAIIRSIDPNDCCQLNRLGSITFLSFNLLLTCFFSECCVKTY 320
            :|::   ||..:|..|.||     .:.:||.||:        |:.|..::.|:.|......::.:
 Worm    40 KWAICDRTLYPIYYLLLIL-----GLNQSIRPNN--------SLLFRIYSWLVFCLLLFTTLRKF 91

  Fly   321 NSISYILHQIGCLP--TAEEFQM--------------------LKMGLKEYILQMQHLK-LLFTC 362
            |       |:|..|  |.|..|.                    |...|:.|.|..:.|| |...|
 Worm    92 N-------QVGVRPNGTRENLQEFFANPRSMITLCNALIMLSGLLASLQLYTLGAKRLKPLKILC 149

  Fly   363 GGLFDINIK----------------LFGGML-VTLC--------GYVIIIV 388
              .|.:|::                :|.|:| :|:.        ||::.||
 Worm   150 --QFSLNVRTKQAERRQFMINTFLAVFSGLLALTMAATYAMSKWGYILYIV 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr98cNP_524531.2 7tm_7 15..393 CDD:285581 40/181 (22%)
lite-1NP_509043.3 7tm_7 75..425 CDD:285581 27/133 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.