DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr98c and Gr59d

DIOPT Version :9

Sequence 1:NP_524531.2 Gene:Gr98c / 117336 FlyBaseID:FBgn0046886 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_611758.2 Gene:Gr59d / 117343 FlyBaseID:FBgn0041236 Length:390 Species:Drosophila melanogaster


Alignment Length:285 Identity:51/285 - (17%)
Similarity:100/285 - (35%) Gaps:81/285 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 RLRLTLSIGLWMVIIIGVIPRLTLGRAGPFFHWVNQVLTQIILIMLQLKGPEYCLFVLLVYELIL 208
            ||.:.|::.:|.|:.:..|              :|.::||..:....::|.         |.|:.
  Fly   154 RLSIALALRIWAVLSLTAI--------------INVIITQYYVATACVRGR---------YALLN 195

  Fly   209 RTRHVLEQLKDDLEDFDCGARIQELCVTLKQNQLLIGRIWRLVDEIGAYFRWSMTLLFLYNGLTI 273
            :....:......|.....|..:.:.|       .|..|:.|:.............|...|.|..:
  Fly   196 KDLQAIVTESQSLVPNGGGVFVTKCC-------YLADRLERIAKSQSDLQELVENLSTAYEGEVV 253

  Fly   274 LHVVNWAIIRSIDPNDCCQLNRLGSITFLSF----------NLLL---TC-------FFSECCVK 318
            ..|:.:            .||.||: ::|.|          |||:   .|       :..:|.:.
  Fly   254 CLVITY------------YLNMLGT-SYLLFSISKYGNFGNNLLVIITLCGIVYFVFYVVDCWIN 305

  Fly   319 TYNSISYIL----HQIGCLPTAEEFQ-----MLKMGLKEYILQMQHLKLLFTCGGLFDI----NI 370
            .:| :.|:|    ..:..|.....||     .|:|..:.:.|.:....|.....|||:.    :.
  Fly   306 AFN-VFYLLDAHDKMVKLLNKRTLFQPGLDHRLEMVFENFALNLVRNPLKLHMYGLFEFGRGTSF 369

  Fly   371 KLFGGMLVTLCGYVIIIVQFKIQDF 395
            .:|..:|.    :.::::|:.:|:|
  Fly   370 AVFNSLLT----HSLLLIQYDVQNF 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr98cNP_524531.2 7tm_7 15..393 CDD:285581 49/281 (17%)
Gr59dNP_611758.2 7tm_7 9..389 CDD:285581 49/282 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.