DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rheb and RAB1A

DIOPT Version :9

Sequence 1:NP_730950.2 Gene:Rheb / 117332 FlyBaseID:FBgn0041191 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_568678.1 Gene:RAB1A / 834766 AraportID:AT5G47200 Length:202 Species:Arabidopsis thaliana


Alignment Length:194 Identity:63/194 - (32%)
Similarity:92/194 - (47%) Gaps:21/194 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IAMMGYRSVGKSSLCIQFVEGQFVDSYDPTIENTFTKIERVKSQDYIVKL--IDTAGQDEYSIFP 70
            :.::|...||||.|.::|.:..::|||..||...| ||..|:.....:||  .|||||:.:....
plant    11 LLLIGDSGVGKSCLLLRFADDSYLDSYISTIGVDF-KIRTVEQDGKTIKLQIWDTAGQERFRTIT 74

  Fly    71 VQYSMDYHGYVLVYSITSQKSFEVVKIIYEKLLDVMGKKYVPVVLVGNKIDLHQERTVSTEEGKK 135
            ..|....||.::.|.:|..:||..||....: :|....:.|..:|||||.||..::.||||..|.
plant    75 SSYYRGAHGIIVTYDVTDLESFNNVKQWLNE-IDRYASENVNKLLVGNKNDLTSQKVVSTETAKA 138

  Fly   136 LAESWRAAFLETSAKQNESVGDIFHQLLILIENE----------------NGNP-QEKSGCLVS 182
            .|:.....|||||||...:|.:.|..:...|:..                .|.| .::|||..|
plant   139 FADELGIPFLETSAKNATNVEEAFMAMTAAIKTRMASQPAGGAKPPTVQIRGQPVNQQSGCCSS 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhebNP_730950.2 RheB 5..182 CDD:206709 62/192 (32%)
RAB1ANP_568678.1 Rab1_Ypt1 7..172 CDD:206661 57/162 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.