DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rheb and RABC2A

DIOPT Version :9

Sequence 1:NP_730950.2 Gene:Rheb / 117332 FlyBaseID:FBgn0041191 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001332165.1 Gene:RABC2A / 831810 AraportID:AT5G03530 Length:210 Species:Arabidopsis thaliana


Alignment Length:202 Identity:65/202 - (32%)
Similarity:92/202 - (45%) Gaps:39/202 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IAMMGYRSVGKSSLCIQFVEGQFVDSYDPTIENTFTKIERVKSQDYIVKLI--DTAGQDEYSIFP 70
            |.::|...||||||.:.|:... |:...|||...| ||:::......:||.  |||||:.:....
plant    16 ILLIGDSGVGKSSLLVSFISSS-VEDLAPTIGVDF-KIKQLTVGGKRLKLTIWDTAGQERFRTLT 78

  Fly    71 VQYSMDYHGYVLVYSITSQKSFEVVKIIYEKLLDVMGKKY--------VPVVLVGNKIDLHQERT 127
            ..|.....|.:|||.:|.:::|       ..|:||.||:.        ...:|||||:|...||.
plant    79 SSYYRGAQGIILVYDVTRRETF-------TNLVDVWGKEIELYSTNQECVRMLVGNKVDRESERG 136

  Fly   128 VSTEEGKKLAESWRAAFLETSAKQNESVGDIFHQLLILIEN-----ENGNPQEK----------- 176
            ||.|||..||:.....|||.||:..::|...|.:|.:.|..     |.|:...|           
plant   137 VSREEGIALAKELNCMFLECSARTRQNVEQCFEELALKIMEVPSLLEEGSSAVKRNILKQKPEHQ 201

  Fly   177 ----SGC 179
                |||
plant   202 TNTQSGC 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhebNP_730950.2 RheB 5..182 CDD:206709 65/202 (32%)
RABC2ANP_001332165.1 PLN03118 1..210 CDD:215587 65/202 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.