DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rheb and RABB1a

DIOPT Version :9

Sequence 1:NP_730950.2 Gene:Rheb / 117332 FlyBaseID:FBgn0041191 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_193449.1 Gene:RABB1a / 827427 AraportID:AT4G17160 Length:205 Species:Arabidopsis thaliana


Alignment Length:194 Identity:56/194 - (28%)
Similarity:91/194 - (46%) Gaps:25/194 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 MMGYRSVGKSSLCIQFVEGQFVDSYDPTIENTF-TKIERVKSQDYIVKLIDTAGQDEYSIFPVQY 73
            ::|...||||.|.::|.:.:|...:|.||...| .|...:.::...:::.|||||:.:......|
plant    11 IIGDTGVGKSCLLLKFTDKRFQAVHDLTIGVEFGAKTITIDNKPIKLQIWDTAGQESFRSVTRSY 75

  Fly    74 SMDYHGYVLVYSITSQKSFEVVKIIYEKLLDVMGKKYVPVVLVGNKIDLHQERTVSTEEGKKLAE 138
            .....|.:|||.||.:::|..:....|:... ...:.:..:|:|||.||..:||||||||::.|.
plant    76 YRGRAGTLLVYDITRRETFNHLASWLEEARQ-HASENMTTMLIGNKCDLEDKRTVSTEEGEQFAR 139

  Fly   139 SWRAAFLETSAKQNESVGDIFHQLLILI-----------ENENG------------NPQEKSGC 179
            .....|:|.|||...:|.:.|.:....|           .||.|            :.|::.||
plant   140 EHGLIFMEASAKTAHNVEEAFVETAATIYKRIQDGVVDEANEPGITPGPFGGKDASSSQQRRGC 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhebNP_730950.2 RheB 5..182 CDD:206709 56/194 (29%)
RABB1aNP_193449.1 PLN03108 1..204 CDD:178655 56/194 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.