DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rheb and Rhebl1

DIOPT Version :9

Sequence 1:NP_730950.2 Gene:Rheb / 117332 FlyBaseID:FBgn0041191 Length:182 Species:Drosophila melanogaster
Sequence 2:XP_006521408.1 Gene:Rhebl1 / 69159 MGIID:1916409 Length:188 Species:Mus musculus


Alignment Length:184 Identity:89/184 - (48%)
Similarity:123/184 - (66%) Gaps:8/184 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MP-TKERHIAMMGYRSVGKSSLCIQFVEGQFVDSYDPTIENTFTKIERVKSQDYIVKLIDTAGQ- 63
            || .:.|.:|::|||||||:||..|||||:|::.||||:|||::|...:...::.:.|:||||| 
Mouse     1 MPLVRYRKVAILGYRSVGKTSLAHQFVEGEFLEGYDPTVENTYSKTVTLGKDEFHLHLVDTAGQV 65

  Fly    64 ---DEYSIFPVQYSMDYHGYVLVYSITSQKSFEVVKIIYEKLLDVMGKKYVPVVLVGNKIDLHQE 125
               |||||.|....:..||||||||:.|.:||::||.:|:||.:..||..:.|:|||||.||..|
Mouse    66 PVADEYSILPYSLIIGVHGYVLVYSVNSLRSFQIVKNLYQKLHEGHGKTRLSVLLVGNKADLSPE 130

  Fly   126 RTVSTEEGKKLAESWRAAFLETSAKQNESVGDIF---HQLLILIENENGNPQEK 176
            |.|...|||||||||.|.|:|:||:.|:...|:|   .|.:..:||..|....:
Mouse   131 REVQAVEGKKLAESWGAMFMESSARDNQLTQDVFIKVIQEIARVENSYGRQDRR 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhebNP_730950.2 RheB 5..182 CDD:206709 87/179 (49%)
Rhebl1XP_006521408.1 P-loop_NTPase 6..188 CDD:393306 87/179 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1320427at2759
OrthoFinder 1 1.000 - - FOG0002658
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24070
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1095
SonicParanoid 1 1.000 - - X2033
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.910

Return to query results.
Submit another query.