DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rheb and RAP1A

DIOPT Version :9

Sequence 1:NP_730950.2 Gene:Rheb / 117332 FlyBaseID:FBgn0041191 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001010935.1 Gene:RAP1A / 5906 HGNCID:9855 Length:184 Species:Homo sapiens


Alignment Length:183 Identity:74/183 - (40%)
Similarity:116/183 - (63%) Gaps:6/183 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KERHIAMMGYRSVGKSSLCIQFVEGQFVDSYDPTIENTFTKIERVKSQDYIVKLIDTAGQDEYSI 68
            :|..:.::|...||||:|.:|||:|.||:.||||||:::.|...|..|..:::::||||.::::.
Human     2 REYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDCQQCMLEILDTAGTEQFTA 66

  Fly    69 FPVQYSMDYHGYVLVYSITSQKSFEVVKIIYEKLLDVMGKKYVPVVLVGNKIDLHQERTVSTEEG 133
            ....|..:..|:.||||||:|.:|..::.:.|::|.|...:.||::|||||.||..||.|..|:|
Human    67 MRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTEDVPMILVGNKCDLEDERVVGKEQG 131

  Fly   134 KKLAESW-RAAFLETSAKQNESVGDIFHQLLILIEN----ENGNPQEKSGCLV 181
            :.||..| ..||||:|||...:|.:||:.|:..|..    |...|::|| ||:
Human   132 QNLARQWCNCAFLESSAKSKINVNEIFYDLVRQINRKTPVEKKKPKKKS-CLL 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhebNP_730950.2 RheB 5..182 CDD:206709 74/182 (41%)
RAP1ANP_001010935.1 Rap1 3..167 CDD:133375 68/163 (42%)
Effector region. /evidence=ECO:0000305 32..40 6/7 (86%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.