DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rheb and diras1b

DIOPT Version :9

Sequence 1:NP_730950.2 Gene:Rheb / 117332 FlyBaseID:FBgn0041191 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001119893.1 Gene:diras1b / 565395 ZFINID:ZDB-GENE-070912-620 Length:198 Species:Danio rerio


Alignment Length:171 Identity:65/171 - (38%)
Similarity:108/171 - (63%) Gaps:10/171 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MP--TKERHIAMMGYRSVGKSSLCIQFVEGQFVDSYDPTIENTFTKIERVKSQDYIVKLIDTAGQ 63
            ||  :.:..:.:.|...||||||.::||:|.|.|:|.||:|:|:.::.........:::.||.|.
Zfish     1 MPEQSNDYRVVVFGAGGVGKSSLVLRFVKGTFRDTYIPTVEDTYRQVISCDKSVCTLQITDTTGS 65

  Fly    64 DEYSIFPVQYSMDY---HGYVLVYSITSQKSFEVVKIIYEKLLDVMGK-KYVPVVLVGNKIDLHQ 124
            .:   ||....:..   |.::|||||||::|.|.:|.||:::|.:.|. :.:|::|||||.| ..
Zfish    66 HQ---FPAMQRLSISKGHAFILVYSITSKQSLEELKPIYQQILAIKGNVENIPIMLVGNKSD-ET 126

  Fly   125 ERTVSTEEGKKLAESWRAAFLETSAKQNESVGDIFHQLLIL 165
            :|.|.||:|:..:::|:.||:|||||.|.:|.::|.:||.|
Zfish   127 QREVKTEDGEAQSKTWKCAFMETSAKTNHNVTELFQELLNL 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhebNP_730950.2 RheB 5..182 CDD:206709 63/165 (38%)
diras1bNP_001119893.1 P-loop_NTPase 7..169 CDD:304359 63/165 (38%)
small_GTPase 17..171 CDD:197466 62/155 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.