DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rheb and rras2

DIOPT Version :9

Sequence 1:NP_730950.2 Gene:Rheb / 117332 FlyBaseID:FBgn0041191 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001017815.1 Gene:rras2 / 550513 ZFINID:ZDB-GENE-050417-352 Length:202 Species:Danio rerio


Alignment Length:183 Identity:68/183 - (37%)
Similarity:108/183 - (59%) Gaps:11/183 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IAMMGYRSVGKSSLCIQFVEGQFVDSYDPTIENTFTKIERVKSQDYIVKLIDTAGQDEYSIFPVQ 72
            :.::|...||||:|.|||::..||..||||||:::||...:..:...:.::|||||:|:.....|
Zfish    15 LVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDERPARLDILDTAGQEEFGAMREQ 79

  Fly    73 YSMDYHGYVLVYSITSQKSFEVVKIIYEKLLDVMGKKYVPVVLVGNKIDLHQERTVSTEEGKKLA 137
            |.....|::||:|:|.:.|||.:.....::|.|..:...|::|||||.||.|:|.|:.|||::||
Zfish    80 YMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILVGNKADLEQQRQVTQEEGQQLA 144

  Fly   138 ESWRAAFLETSAKQNESVGDIFHQLLILI----ENE-------NGNPQEKSGC 179
            ...:..::|.|||...:|...||:|:.:|    |.|       ....::||||
Zfish   145 RQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQEQECPPSPEPTRKEKDKSGC 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhebNP_730950.2 RheB 5..182 CDD:206709 68/183 (37%)
rras2NP_001017815.1 M_R_Ras_like 11..174 CDD:133345 61/158 (39%)
RAS 25..176 CDD:214541 59/150 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.