DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rheb and rhebl1

DIOPT Version :9

Sequence 1:NP_730950.2 Gene:Rheb / 117332 FlyBaseID:FBgn0041191 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_988937.1 Gene:rhebl1 / 394534 XenbaseID:XB-GENE-493839 Length:184 Species:Xenopus tropicalis


Alignment Length:182 Identity:86/182 - (47%)
Similarity:120/182 - (65%) Gaps:2/182 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PTKERHIAMMGYRSVGKSSLCIQFVEGQFVDSYDPTIENTFTKIERVKSQDYIVKLIDTAGQDEY 66
            |.|.|.|.|:||.|||||||.:||::|.|...|:||||||::|...:.|.::.:.::||||||||
 Frog     3 PVKHRKIVMLGYPSVGKSSLALQFIKGDFPKDYEPTIENTWSKTFVMGSDEFELDVVDTAGQDEY 67

  Fly    67 SIFPVQYSMDYHGYVLVYSITSQKSFEVVKIIYEKLLDVMGKKYVPVVLVGNKIDLHQE-RTVST 130
            |:.|..:....|||::|||:...:||::.:.|:..|:|..||..:|:||||||.||... |.|..
 Frog    68 SLLPQSFIFGIHGYIVVYSVACSRSFQIARAIHSILVDRRGKCLMPIVLVGNKNDLPTHCREVKP 132

  Fly   131 EEGKKLAESWRAAFLETSAKQNESVGDIFHQLLILIEN-ENGNPQEKSGCLV 181
            |:||||||||.|||||.|||..|....||.:::..|:. |....:||..|::
 Frog   133 EDGKKLAESWGAAFLEVSAKDPERSKLIFTKMIEEIDRVERSFGEEKKCCVM 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhebNP_730950.2 RheB 5..182 CDD:206709 84/179 (47%)
rhebl1NP_988937.1 RheB 6..184 CDD:206709 84/177 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1320427at2759
OrthoFinder 1 1.000 - - FOG0002658
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24070
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1095
SonicParanoid 1 1.000 - - X2033
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.050

Return to query results.
Submit another query.