DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rheb and CG13375

DIOPT Version :9

Sequence 1:NP_730950.2 Gene:Rheb / 117332 FlyBaseID:FBgn0041191 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001162628.1 Gene:CG13375 / 30976 FlyBaseID:FBgn0040370 Length:306 Species:Drosophila melanogaster


Alignment Length:171 Identity:55/171 - (32%)
Similarity:82/171 - (47%) Gaps:12/171 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PTKERH-IAMMGYRSVGKSSLCIQFVEGQFVDSYDPTIENTFTKIERVKSQDYIVKLIDTAGQDE 65
            |...|| |.:||...|||:|:..||:...|...|..|||........:......:.::||||..|
  Fly    43 PANARHKIVVMGSAKVGKTSIITQFLYNTFSTKYKRTIEEMHQGNFSIAGVSLTLDILDTAGSYE 107

  Fly    66 YSIFPVQYSMDY---HGYVLVYSITSQKSFEVVKIIYEKLLDVMGKKYVPVVLVGNKIDLHQERT 127
               ||...::..   ..::|||.:|...:||.|:.|.:::.:......||:|:|||||||..:..
  Fly   108 ---FPAMRALSISSADAFILVYDVTDATTFEEVRTIRDQIHETKATTAVPIVVVGNKIDLLADGE 169

  Fly   128 VSTEEGKKLAES-----WRAAFLETSAKQNESVGDIFHQLL 163
            ...|......||     |...|:|.||..||::..:|.:||
  Fly   170 TEREVEYATTESVVTVDWENGFVEASASSNENITQVFKELL 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhebNP_730950.2 RheB 5..182 CDD:206709 54/168 (32%)
CG13375NP_001162628.1 RAS 48..215 CDD:214541 53/166 (32%)
Ras_dva 49..239 CDD:206714 52/165 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453069
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24070
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.