DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rheb and ras1

DIOPT Version :9

Sequence 1:NP_730950.2 Gene:Rheb / 117332 FlyBaseID:FBgn0041191 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_593579.1 Gene:ras1 / 2542285 PomBaseID:SPAC17H9.09c Length:219 Species:Schizosaccharomyces pombe


Alignment Length:172 Identity:70/172 - (40%)
Similarity:108/172 - (62%) Gaps:0/172 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KERHIAMMGYRSVGKSSLCIQFVEGQFVDSYDPTIENTFTKIERVKSQDYIVKLIDTAGQDEYSI 68
            :|..:.::|...||||:|.||.::..|||.||||||:::.|...:..:..::.::|||||:|||.
pombe     7 REYKLVVVGDGGVGKSALTIQLIQSHFVDEYDPTIEDSYRKKCEIDGEGALLDVLDTAGQEEYSA 71

  Fly    69 FPVQYSMDYHGYVLVYSITSQKSFEVVKIIYEKLLDVMGKKYVPVVLVGNKIDLHQERTVSTEEG 133
            ...||.....|::|||:|||:.||:.:...|:::|.|..|...|||||.||.||..||.||..||
pombe    72 MREQYMRTGEGFLLVYNITSRSSFDEISTFYQQILRVKDKDTFPVVLVANKCDLEAERVVSRAEG 136

  Fly   134 KKLAESWRAAFLETSAKQNESVGDIFHQLLILIENENGNPQE 175
            ::||:|....::|||||...:|.:.|:.|:..|...|.:.::
pombe   137 EQLAKSMHCLYVETSAKLRLNVEEAFYSLVRTIRRYNKSEEK 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhebNP_730950.2 RheB 5..182 CDD:206709 70/171 (41%)
ras1NP_593579.1 small_GTPase 7..172 CDD:197466 69/164 (42%)
H_N_K_Ras_like 8..170 CDD:133338 68/161 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.