DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rheb and rhb1

DIOPT Version :9

Sequence 1:NP_730950.2 Gene:Rheb / 117332 FlyBaseID:FBgn0041191 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_595194.1 Gene:rhb1 / 2540853 PomBaseID:SPBC428.16c Length:185 Species:Schizosaccharomyces pombe


Alignment Length:184 Identity:96/184 - (52%)
Similarity:133/184 - (72%) Gaps:4/184 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PTKERHIAMMGYRSVGKSSLCIQFVEGQFVDSYDPTIENTFTKIERVKSQDYIVKLIDTAGQDEY 66
            |.|.|.||::|.||||||||.:|:||..||:||.|||||||:|..:.|.|::..::|||||||||
pombe     3 PIKSRRIAVLGSRSVGKSSLTVQYVENHFVESYYPTIENTFSKNIKYKGQEFATEIIDTAGQDEY 67

  Fly    67 SIFPVQYSMDYHGYVLVYSITSQKSFEVVKIIYEKLLDVMGKKYVPVVLVGNKIDLHQERTVSTE 131
            ||...::|:..|||||||||||:.|||:|||:.:|:|:..|.::||:|:||||.|||.:|.|:.|
pombe    68 SILNSKHSIGIHGYVLVYSITSKSSFEMVKIVRDKILNHTGTEWVPIVVVGNKSDLHMQRAVTAE 132

  Fly   132 EGKKLAESWRAAFLETSAKQNESVGDIFHQLLILIENENGNPQ---EKSGCLVS 182
            |||.||..|:.|:.|.||:.||:|...|..::..||.: .||.   :..||:::
pombe   133 EGKALANEWKCAWTEASARHNENVARAFELIISEIEKQ-ANPSPPGDGKGCVIA 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhebNP_730950.2 RheB 5..182 CDD:206709 94/179 (53%)
rhb1NP_595194.1 small_GTPase 5..170 CDD:197466 91/164 (55%)
RheB 6..184 CDD:206709 94/178 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 181 1.000 Domainoid score I802
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 193 1.000 Inparanoid score I1035
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002658
OrthoInspector 1 1.000 - - oto101403
orthoMCL 1 0.900 - - OOG6_104157
Panther 1 1.100 - - LDO PTHR24070
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1095
SonicParanoid 1 1.000 - - X2033
TreeFam 1 0.960 - -
1211.850

Return to query results.
Submit another query.