DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rheb and MRAS

DIOPT Version :9

Sequence 1:NP_730950.2 Gene:Rheb / 117332 FlyBaseID:FBgn0041191 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001078518.1 Gene:MRAS / 22808 HGNCID:7227 Length:208 Species:Homo sapiens


Alignment Length:177 Identity:65/177 - (36%)
Similarity:107/177 - (60%) Gaps:3/177 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPTKERHIAMMGYRSVGKSSLCIQFVEGQFVDSYDPTIENTFTKIERVKSQDYIVKLIDTAGQDE 65
            :||.:  :.::|...||||:|.|||.:..||..||||||:::.|...:.:|..|:.::|||||:|
Human    11 LPTYK--LVVVGDGGVGKSALTIQFFQKIFVPDYDPTIEDSYLKHTEIDNQWAILDVLDTAGQEE 73

  Fly    66 YSIFPVQYSMDYHGYVLVYSITSQKSFEVVKIIYEKLLDVMGKKYVPVVLVGNKIDLHQERTVST 130
            :|....||.....|:::|||:|.:.|||.|...::.:|.|..::..|::||.||:||...|.::.
Human    74 FSAMREQYMRTGDGFLIVYSVTDKASFEHVDRFHQLILRVKDRESFPMILVANKVDLMHLRKITR 138

  Fly   131 EEGKKLAESWRAAFLETSAKQNE-SVGDIFHQLLILIENENGNPQEK 176
            |:||::|......::|||||... :|...||.|:.:|..:.....:|
Human   139 EQGKEMATKHNIPYIETSAKDPPLNVDKAFHDLVRVIRQQIPEKSQK 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhebNP_730950.2 RheB 5..182 CDD:206709 63/173 (36%)
MRASNP_001078518.1 M_R_Ras_like 12..176 CDD:133345 63/165 (38%)
Effector region 42..50 6/7 (86%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.