DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rheb and drn-1

DIOPT Version :9

Sequence 1:NP_730950.2 Gene:Rheb / 117332 FlyBaseID:FBgn0041191 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001333544.2 Gene:drn-1 / 183765 WormBaseID:WBGene00016911 Length:219 Species:Caenorhabditis elegans


Alignment Length:193 Identity:66/193 - (34%)
Similarity:113/193 - (58%) Gaps:20/193 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TKERHIAMMGYRSVGKSSLCIQFVEGQFVDSYDPTIENTFTKIERVKSQDY-IVKLIDTAGQDEY 66
            |.:..:|:.|...|||||:..:||:|.|.::|.||||:|:.::.....::. .:::.||.|..: 
 Worm    28 TSDYRVAVFGAGGVGKSSITQRFVKGTFNENYVPTIEDTYRQVISCNQKNVCTLQITDTTGSHQ- 91

  Fly    67 SIFPVQYSMDY---HGYVLVYSITSQKSF-EVVKIIYEKLLDVMGKKY--VPVVLVGNKIDLHQE 125
              ||....:..   :.::|:||:|:::|| |:|.|| |.:.:|.|...  .|::|||||.|...:
 Worm    92 --FPAMQRLSISKGNAFILIYSVTNKQSFAELVPII-EMMKEVKGNAIAETPIMLVGNKKDEESK 153

  Fly   126 RTVSTEEGKKLAESWRAAFLETSAKQNESVGDIFHQLLIL---------IENENGNPQEKSGC 179
            |.||:..|:|:|.:....|:|||||.||::.::|.|||.|         :::.:|...:|.||
 Worm   154 REVSSNSGQKVATNMECGFIETSAKNNENITELFQQLLALEKKRQLALTMDDPDGKNGKKKGC 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhebNP_730950.2 RheB 5..182 CDD:206709 65/191 (34%)
drn-1NP_001333544.2 P-loop_NTPase 30..195 CDD:328724 61/168 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.