DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rheb and rheb-1

DIOPT Version :9

Sequence 1:NP_730950.2 Gene:Rheb / 117332 FlyBaseID:FBgn0041191 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_499079.1 Gene:rheb-1 / 176327 WormBaseID:WBGene00010038 Length:207 Species:Caenorhabditis elegans


Alignment Length:173 Identity:74/173 - (42%)
Similarity:113/173 - (65%) Gaps:2/173 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RHIAMMGYRSVGKSSLCIQFVEGQFVDSYDPTIENTFTKIERVKSQDYIVKLIDTAGQDEYSIFP 70
            |.:|:|||..||||:|.::|.:..|.:.|:.|||:..:|......:||.:::.|||||.||::||
 Worm    14 RKVAVMGYPHVGKSALVLRFTQNIFPERYESTIEDQHSKHIAAFHRDYHLRVTDTAGQQEYTVFP 78

  Fly    71 VQYSMDYHGYVLVYSITSQKSFEVVKIIYEKLLDVMGKKYVPVVLVGNKIDLHQERTVSTEEGKK 135
            ...|:|.:|::|||:|..:||||:...||||::...|...:|:|:||||.||..:|.|..|||::
 Worm    79 RSCSLDINGFILVYAIDDRKSFEMCSNIYEKIVRTYGDTSIPIVIVGNKTDLSTQRVVRAEEGEE 143

  Fly   136 LAESWRAAFLETSAKQNESVGDIFHQLLILIENENGN--PQEK 176
            ||..|.|.|:|.:|:::..|.::|..||..||...||  |.|:
 Worm   144 LARQWDAKFVEITARESNRVHEVFELLLREIEISRGNLSPTER 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhebNP_730950.2 RheB 5..182 CDD:206709 74/173 (43%)
rheb-1NP_499079.1 RheB 13..207 CDD:206709 74/173 (43%)
small_GTPase 13..177 CDD:197466 70/162 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 142 1.000 Domainoid score I2913
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 148 1.000 Inparanoid score I2991
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1320427at2759
OrthoFinder 1 1.000 - - FOG0002658
OrthoInspector 1 1.000 - - oto17970
orthoMCL 1 0.900 - - OOG6_104157
Panther 1 1.100 - - LDO PTHR24070
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1095
SonicParanoid 1 1.000 - - X2033
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.