DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rheb and ras-1

DIOPT Version :9

Sequence 1:NP_730950.2 Gene:Rheb / 117332 FlyBaseID:FBgn0041191 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_496623.1 Gene:ras-1 / 174875 WormBaseID:WBGene00004310 Length:212 Species:Caenorhabditis elegans


Alignment Length:159 Identity:61/159 - (38%)
Similarity:99/159 - (62%) Gaps:0/159 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IAMMGYRSVGKSSLCIQFVEGQFVDSYDPTIENTFTKIERVKSQDYIVKLIDTAGQDEYSIFPVQ 72
            |.::|...||||:|.|||::..||..||||||:::||...|......::::|||||:|:|....|
 Worm    20 IVVVGGGGVGKSALTIQFIQRYFVQDYDPTIEDSYTKQCFVDEDLCKLEILDTAGQEEFSTMREQ 84

  Fly    73 YSMDYHGYVLVYSITSQKSFEVVKIIYEKLLDVMGKKYVPVVLVGNKIDLHQERTVSTEEGKKLA 137
            |.....|:::|:::|.:.|||.||.::|.:..:..:...|::|||||.||..||.|:..|.::||
 Worm    85 YLRTGSGFLIVFAVTDRNSFEEVKKLHELICRIKDRDDFPIILVGNKADLENERHVARHEAEELA 149

  Fly   138 ESWRAAFLETSAKQNESVGDIFHQLLILI 166
            ......:||.|||..::|.:.|..::.|:
 Worm   150 HRLSIPYLECSAKIRKNVDEAFFDIVRLV 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhebNP_730950.2 RheB 5..182 CDD:206709 61/159 (38%)
ras-1NP_496623.1 small_GTPase 30..181 CDD:197466 57/149 (38%)
M_R_Ras_like 30..179 CDD:133345 57/149 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.