DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rheb and Rap2b

DIOPT Version :9

Sequence 1:NP_730950.2 Gene:Rheb / 117332 FlyBaseID:FBgn0041191 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_596901.1 Gene:Rap2b / 170923 RGDID:620591 Length:183 Species:Rattus norvegicus


Alignment Length:176 Identity:69/176 - (39%)
Similarity:112/176 - (63%) Gaps:1/176 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KERHIAMMGYRSVGKSSLCIQFVEGQFVDSYDPTIENTFTKIERVKSQDYIVKLIDTAGQDEYSI 68
            :|..:.::|...||||:|.:|||.|.|::.||||||:.:.|...|.|...:::::||||.::::.
  Rat     2 REYKVVVLGSGGVGKSALTVQFVTGSFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFAS 66

  Fly    69 FPVQYSMDYHGYVLVYSITSQKSFEVVKIIYEKLLDVMGKKYVPVVLVGNKIDLHQERTVSTEEG 133
            ....|..:..|::||||:.:|:||:.:|.:.::::.|...:.||::|||||:||..||.||..||
  Rat    67 MRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQIIRVKRYERVPMILVGNKVDLEGEREVSYGEG 131

  Fly   134 KKLAESWRAAFLETSAKQNESVGDIFHQLLILIENENGNPQEKSGC 179
            |.|||.|...|:|||||...||.::|.:::..: |....|....||
  Rat   132 KALAEEWSCPFMETSAKNKASVDELFAEIVRQM-NYAAQPNGDEGC 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhebNP_730950.2 RheB 5..182 CDD:206709 69/175 (39%)
Rap2bNP_596901.1 Rap2 3..165 CDD:133376 65/162 (40%)
Effector region. /evidence=ECO:0000305 32..40 6/7 (86%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.