DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rheb and Hras

DIOPT Version :9

Sequence 1:NP_730950.2 Gene:Rheb / 117332 FlyBaseID:FBgn0041191 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001123915.1 Gene:Hras / 15461 MGIID:96224 Length:189 Species:Mus musculus


Alignment Length:188 Identity:70/188 - (37%)
Similarity:108/188 - (57%) Gaps:11/188 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ERHIAMMGYRSVGKSSLCIQFVEGQFVDSYDPTIENTFTKIERVKSQDYIVKLIDTAGQDEYSIF 69
            |..:.::|...||||:|.||.::..|||.||||||:::.|...:..:..::.::|||||:|||..
Mouse     3 EYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAM 67

  Fly    70 PVQYSMDYHGYVLVYSITSQKSFEVVKIIYEKLLDVMGKKYVPVVLVGNKIDLHQERTVSTEEGK 134
            ..||.....|::.|::|.:.||||.:....|::..|.....||:||||||.|| ..|||.:.:.:
Mouse    68 RDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL-AARTVESRQAQ 131

  Fly   135 KLAESWRAAFLETSAKQNESVGDIFHQLLILIEN---ENGNPQEKSG-------CLVS 182
            .||.|:...::|||||..:.|.|.|:.|:..|..   ...||.::||       |::|
Mouse   132 DLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPGCMSCKCVLS 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhebNP_730950.2 RheB 5..182 CDD:206709 69/186 (37%)
HrasNP_001123915.1 H_N_K_Ras_like 3..164 CDD:133338 63/161 (39%)
Effector region 32..40 6/7 (86%)
Hypervariable region 166..185 4/18 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.