DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rheb and RHEBL1

DIOPT Version :9

Sequence 1:NP_730950.2 Gene:Rheb / 117332 FlyBaseID:FBgn0041191 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_653194.1 Gene:RHEBL1 / 121268 HGNCID:21166 Length:183 Species:Homo sapiens


Alignment Length:178 Identity:92/178 - (51%)
Similarity:125/178 - (70%) Gaps:2/178 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MP-TKERHIAMMGYRSVGKSSLCIQFVEGQFVDSYDPTIENTFTKIERVKSQDYIVKLIDTAGQD 64
            || .:.|.:.::|||.|||:||..|||||:|.:.||||:|||::||..:...::.:.|:||||||
Human     1 MPLVRYRKVVILGYRCVGKTSLAHQFVEGEFSEGYDPTVENTYSKIVTLGKDEFHLHLVDTAGQD 65

  Fly    65 EYSIFPVQYSMDYHGYVLVYSITSQKSFEVVKIIYEKLLDVMGKKYVPVVLVGNKIDLHQERTVS 129
            ||||.|..:.:..||||||||:||..||:|::.:|:||.:..||..|||||||||.||..||.|.
Human    66 EYSILPYSFIIGVHGYVLVYSVTSLHSFQVIESLYQKLHEGHGKTRVPVVLVGNKADLSPEREVQ 130

  Fly   130 TEEGKKLAESWRAAFLETSAKQNESVGDIFHQLLILIEN-ENGNPQEK 176
            ..|||||||||.|.|:|:||::|:....||.:::..|.. ||...||:
Human   131 AVEGKKLAESWGATFMESSARENQLTQGIFTKVIQEIARVENSYGQER 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhebNP_730950.2 RheB 5..182 CDD:206709 90/173 (52%)
RHEBL1NP_653194.1 small_GTPase 5..169 CDD:197466 86/163 (53%)
RheB 6..183 CDD:206709 90/173 (52%)
Effector region 35..43 6/7 (86%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1320427at2759
OrthoFinder 1 1.000 - - FOG0002658
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24070
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2033
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
76.880

Return to query results.
Submit another query.