DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr98b and Gr68a

DIOPT Version :9

Sequence 1:NP_733213.1 Gene:Gr98b / 117327 FlyBaseID:FBgn0046887 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_524027.2 Gene:Gr68a / 39324 FlyBaseID:FBgn0041231 Length:389 Species:Drosophila melanogaster


Alignment Length:443 Identity:79/443 - (17%)
Similarity:153/443 - (34%) Gaps:138/443 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 YLDIFSVFALTPPPQSFGHTPHR--------RL----RWYLMTGYVFYATAILATVFIVSYFNII 67
            |.||:.:   :.|.|.|...|..        |.    |||         ..::|.:.::   ..:
  Fly     4 YQDIYPI---SKPSQIFAILPFYSGDVDDGFRFGGLGRWY---------GRLVALIILI---GSL 53

  Fly    68 AIDEEVL----EYNV-----SDFTRVMGNIQKSL----YSIMAIANHLNMLINYRRLGGIYKDIA 119
            .:.|:||    ||.:     .|...:...|:..|    |:::.:::..|...::|.|    .|||
  Fly    54 TLGEDVLFASKEYRLVASAQGDTEEINRTIETLLCIISYTMVVLSSVQNASRHFRTL----HDIA 114

  Fly   120 DLEMDMDEASQCFGGQRQRFSFRFRMALCVGVWMILMVGSMPRLTMTAMGPFVSTLL-------- 176
            .::..:     ...|.|:.:|.|                ::..|..:|.|..::...        
  Fly   115 KIDEYL-----LANGFRETYSCR----------------NLTILVTSAAGGVLAVAFYYIHYRSG 158

  Fly   177 -----KILTEFVMIMQQLKSLEYCVFVLIIYELVLRLRRTLSQLQEE-----FQDC-------EQ 224
                 :|:...:..:|.|.|   .:..|.:..|::.|.:.:..|.::     .|||       |.
  Fly   159 IGAKRQIILLLIYFLQLLYS---TLLALYLRTLMMNLAQRIGFLNQKLDTFNLQDCGHMENWREL 220

  Fly   225 QDMLQALCVALKRNQLLLGRIWRLEGDVGSYFTPTM-----LLLFLYNGLTILHMVNWAYINKFL 284
            .::::.||..                   .|.|..:     :.|..|.|.:...:.|.:|:....
  Fly   221 SNLIEVLCKF-------------------RYITENINCVAGVSLLFYFGFSFYTVTNQSYLAFAT 266

  Fly   285 YDSCCQYERFLVCSTL----------LVNLLLPCLLSQRCINAYNCFPRILHKIRCTSAD-PNF- 337
            ..:.....:..|..|:          .:.:::.|.......:..|...:||.:|...|.. .|. 
  Fly   267 LTAGSLSSKTEVADTIGLSCIWVLAETITMIVICSACDGLASEVNGTAQILARIYGKSKQFQNLI 331

  Fly   338 -AMLTRGLREYSLQMEHLKLRFTCGGLFDINLKYFGGLLVTIFGYIIILIQFK 389
             ..||:.:::        .|:||..|.|.|:......:...:..|::||||||
  Fly   332 DKFLTKSIKQ--------DLQFTAYGFFSIDNSTLFKIFSAVTTYLVILIQFK 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr98bNP_733213.1 7tm_7 13..391 CDD:285581 79/443 (18%)
Gr68aNP_524027.2 7tm_7 7..379 CDD:285581 77/440 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450302
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.