DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr98b and Gr63a

DIOPT Version :9

Sequence 1:NP_733213.1 Gene:Gr98b / 117327 FlyBaseID:FBgn0046887 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001137883.1 Gene:Gr63a / 38453 FlyBaseID:FBgn0035468 Length:489 Species:Drosophila melanogaster


Alignment Length:385 Identity:75/385 - (19%)
Similarity:144/385 - (37%) Gaps:138/385 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 YATAILATVFIVSYFNIIAI------------------DEEVLEYNVSDFTRVMGNIQKSLY--S 94
            :..|::|.:|:|:...|:.|                  |.|||.|.:|..:..:...||::|  .
  Fly   141 FEEAVIAYLFLVNILPIMIIPILWYEARKIAKLFNDWDDFEVLYYQISGHSLPLKLRQKAVYIAI 205

  Fly    95 IMAIANHLNMLINYRRLGGIYKDIADLEMDMDEASQCFGGQRQRFSFRFRMALCVGVWMILMVGS 159
            ::.|.:.|:::|.       :..::||.::          |...:.....:...:|.|..|:..:
  Fly   206 VLPILSVLSVVIT-------HVTMSDLNIN----------QVVPYCILDNLTAMLGAWWFLICEA 253

  Fly   160 MPRLTMTA-------------MGPFVSTLLKILTEFVMIMQQLKSL------EYC---VF--VLI 200
            |   ::||             :||     ..::.::.::..:|..|      ..|   ||  :.:
  Fly   254 M---SITAHLLAERFQKALKHIGP-----AAMVADYRVLWLRLSKLTRDTGNALCYTFVFMSLYL 310

  Fly   201 IYELVLRLRRTLSQLQEEFQDCEQQDMLQALCVALKRNQLLLGRIWRLEGDVGSYFTPTMLLLFL 265
            .:.:.|.:...:|||.|.|              .:|...|.:..:|    ::|        |||.
  Fly   311 FFIITLSIYGLMSQLSEGF--------------GIKDIGLTITALW----NIG--------LLFY 349

  Fly   266 YNGLTILHMVNWAYINKFLYDSCCQYERFLVCSTLLVNLLLPCLLSQRCINAYNCFPRILHKIRC 330
                 |....::|.:|     ....:::.|    |:|.|......:|..||.:         :|.
  Fly   350 -----ICDEAHYASVN-----VRTNFQKKL----LMVELNWMNSDAQTEINMF---------LRA 391

  Fly   331 TSADPNFAMLTRGLREYSLQMEHLKLRFTCGGLFDINLKYFGGLLVTIFGYIIILIQFKV 390
            |..:|:                    ...|||.||:|...|.|||.|:..|:::|:||::
  Fly   392 TEMNPS--------------------TINCGGFFDVNRTLFKGLLTTMVTYLVVLLQFQI 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr98bNP_733213.1 7tm_7 13..391 CDD:285581 75/385 (19%)
Gr63aNP_001137883.1 7tm_7 79..433 CDD:285581 75/385 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.