DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr98b and Gr33a

DIOPT Version :9

Sequence 1:NP_733213.1 Gene:Gr98b / 117327 FlyBaseID:FBgn0046887 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_525102.4 Gene:Gr33a / 34641 FlyBaseID:FBgn0032416 Length:475 Species:Drosophila melanogaster


Alignment Length:159 Identity:38/159 - (23%)
Similarity:68/159 - (42%) Gaps:18/159 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   250 GDVGSYFTPTMLLLFLYN--GLTILHMVNWAYINKFLYDSCCQYERFLVCSTLLVNLLLPCLLSQ 312
            |:.|....|.|...|:.:  |:.:...||:....|   .....|..:|........:::..::.:
  Fly   318 GEFGPQCVPYMAACFVVSIFGIFLETKVNFIVGGK---SRLLDYMTYLYVIWSFTTMMVAYIVLR 379

  Fly   313 RCINAYNCFPR---ILHKIRCTSADPNFAMLTRGL-----REYSLQMEHLK--LRFTCGGLFDIN 367
            .|.||.|...:   |:|:|  ....|.| ||:..|     :.::||..|.:  .:|...|||.::
  Fly   380 LCCNANNHSKQSAMIVHEI--MQKKPAF-MLSNDLFYNKMKSFTLQFLHWEGFFQFNGVGLFALD 441

  Fly   368 LKYFGGLLVTIFGYIIILIQFKVQAIAAN 396
            ..:....:.....|:|:|:||.:.||..|
  Fly   442 YTFIFSTVSAATSYLIVLLQFDMTAILRN 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr98bNP_733213.1 7tm_7 13..391 CDD:285581 35/152 (23%)
Gr33aNP_525102.4 7tm_7 <289..465 CDD:303125 35/152 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.