DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr98b and Gr9a

DIOPT Version :9

Sequence 1:NP_733213.1 Gene:Gr98b / 117327 FlyBaseID:FBgn0046887 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_727392.1 Gene:Gr9a / 318158 FlyBaseID:FBgn0052693 Length:341 Species:Drosophila melanogaster


Alignment Length:380 Identity:66/380 - (17%)
Similarity:115/380 - (30%) Gaps:164/380 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RRLRWYL-------MTGYVFYATAILATVFIVSYFNIIAIDEEVLEYNVSDFTRVMGNIQKSLYS 94
            ||.|:.|       .|.:::....:...:|..:.|.:::      ||.:...  .:.|::.: ||
  Fly    92 RRFRYLLEELPPVKATSFIYRHLILEIILFACNAFLVLS------EYTIRGI--YLENLRYA-YS 147

  Fly    95 IMAI-ANHLNMLINYRRLGG--------------IYK----DIADLEMDMDEASQCFGGQRQRFS 140
            :.|: |.:|.|::...||.|              .||    |.|.|.......|..||     .|
  Fly   148 LQAVRARYLQMMVLVDRLDGKLEQLHHRVISGSSDYKTLRLDYAHLAKVTRSLSHLFG-----LS 207

  Fly   141 FRFRMALCVGVWMILMVGSMPRLTMTAMGPFVSTLLKILTEFVMIMQQLKSLEYC-VFVLIIYEL 204
            ......||:|.|:|:                                       | |:.::.|  
  Fly   208 LLLLNVLCLGDWIIV---------------------------------------CNVYFMVAY-- 231

  Fly   205 VLRLRRTLSQLQEEFQDCEQQDMLQALCVALKRNQLLLGRIWRLEGDVGSYFTPTMLLLFLYNGL 269
                                   ||.|                          |..|.||   |.
  Fly   232 -----------------------LQVL--------------------------PATLFLF---GQ 244

  Fly   270 TILHMVNWAYINKFLYDSCCQYERFLVCSTLLVNLLLPCLLSQRCINAYNCFPRILHKIRCTSAD 334
            .:                      |:||.| |:.:...|..|.||::......:.|..:      
  Fly   245 VM----------------------FVVCPT-LIKIWSICAASHRCVSKSKHLQQQLKDL------ 280

  Fly   335 PNFAMLTRG-LREYSLQMEHLKLRFTCGGLFDINLKYFGGLLVTIFGYIIILIQF 388
            |....:.|. :..::||:....::....|::.:||:...|:...|...::|.:||
  Fly   281 PGQTPVERSQIEGFALQIMQDPIQIDVCGIYHLNLQTLAGMFFFILEALVIFLQF 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr98bNP_733213.1 7tm_7 13..391 CDD:285581 66/380 (17%)
Gr9aNP_727392.1 7tm_7 7..335 CDD:285581 64/378 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.