DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr98b and Gr10a

DIOPT Version :9

Sequence 1:NP_733213.1 Gene:Gr98b / 117327 FlyBaseID:FBgn0046887 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_727523.1 Gene:Gr10a / 117501 FlyBaseID:FBgn0045502 Length:408 Species:Drosophila melanogaster


Alignment Length:425 Identity:92/425 - (21%)
Similarity:142/425 - (33%) Gaps:128/425 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 YLDIFSVFALTPPPQSFGH-------TPHRRLRWYLMTGYV-FYATAILATVFIVSYFNIIAIDE 71
            |..:||:..:...|..|.:       |..|||:   :..|| |..|||.....||:|        
  Fly    53 YGHLFSMLLIVVLPGYFCYHFRTLTDTLDRRLQ---LLFYVSFTNTAIKYATVIVTY-------- 106

  Fly    72 EVLEYNVSDFTRVMGNIQKSLYSIMAIANHLNM-LINYRRLGGIYKDIADLEMDMDEASQCFGGQ 135
                                      :||.::. .||.|    .......||.:...|.|   ..
  Fly   107 --------------------------VANTVHFEAINQR----CTMQRTHLEFEFKNAPQ---EP 138

  Fly   136 RQRFSF--RFRMALCVGVWMILMVGSMPRLTMTAMGPFVSTLLKI-LTEFVMIMQQLKSLEYCVF 197
            ::.|.|  .|:..|...:.||.:.|...:......|......:.. :..||:........:||.|
  Fly   139 KRPFEFFMYFKFCLINLMMMIQVCGIFAQYGEVGKGSVSQVRVHFAIYAFVLWNYTENMADYCYF 203

  Fly   198 V---LIIYELVLRLRRTLSQLQEEFQD-----------CEQQDMLQAL---CVA---LKRNQLLL 242
            :   ::.|.....|:  |..|::|...           ||..|.|:.|   |..   |:|....:
  Fly   204 INGSVLKYYRQFNLQ--LGSLRDEMDGLRPGGMLLHHCCELSDRLEELRRRCREIHDLQRESFRM 266

  Fly   243 GRIWRLEGDVGSYFTPTMLLLFLYNGL----TILHM--------------VNWAYINKFLYDSCC 289
            .: ::|.|         ::|..|.|.|    |:.||              |...|...|..|:  
  Fly   267 HQ-FQLIG---------LMLSTLINNLTNFYTLFHMLAKQSLEEVSYPVVVGSVYATGFYIDT-- 319

  Fly   290 QYERFLVCSTLLVNLLLPCLLSQRCINAYNCFPRILHKIRCTSADPNFAMLTRGLREYSLQMEHL 354
             |...|:...:.:.|....|..:|...     ||.:.:           .|||.:...||::.:.
  Fly   320 -YIVALINEHIKLELEAVALTMRRFAE-----PREMDE-----------RLTREIEHLSLELLNY 367

  Fly   355 KLRFTCGGL-FDINLKYFGGLLVTIFGYIIILIQF 388
            :....||.| .|..|.|.  :.||.|.|.|.|:||
  Fly   368 QPPMLCGLLHLDRRLVYL--IAVTAFSYFITLVQF 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr98bNP_733213.1 7tm_7 13..391 CDD:285581 92/425 (22%)
Gr10aNP_727523.1 7tm_7 20..402 CDD:285581 92/425 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.