DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr98b and Gr36b

DIOPT Version :9

Sequence 1:NP_733213.1 Gene:Gr98b / 117327 FlyBaseID:FBgn0046887 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_724039.1 Gene:Gr36b / 117487 FlyBaseID:FBgn0045486 Length:391 Species:Drosophila melanogaster


Alignment Length:382 Identity:69/382 - (18%)
Similarity:138/382 - (36%) Gaps:57/382 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 TGYVFYATAILATVFIVSYFNIIAI--------DEEVLEYNVSDFTRVMGNIQKSLYSIMAIANH 101
            ||.||.:.......|:.:.|.:|.|        |..:|..:.:.....:..|...|..:..:...
  Fly    30 TGRVFKSRRCTIYAFMANIFILITIIYNFTAHGDTNLLFQSANKLHEYVIIIMSGLKIVAGLITV 94

  Fly   102 LNMLINYRRLGGIYKDIADLEMDMDEASQCFGGQRQRFSFRFRMALCVGVWMILMVGSMPRLTMT 166
            ||..:...::..:.||:..|.|...:.....     |:....:..:...:.::.:..|:..|...
  Fly    95 LNRWLQRGQMMQLVKDVIRLYMINPQLKSMI-----RWGILLKAFISFAIELLQVTLSVDALDRQ 154

  Fly   167 AMGPFVSTLLKILTEFVMIMQQLKSLEYCVFVLII----------YELVLRLRRTLSQLQEE--- 218
            .....:..|:|:...|:|   .|...::.:.:|:|          ..:|:...|.||.||..   
  Fly   155 GTAEMMGLLVKLCVSFIM---NLAISQHFLVILLIRAQYRIMNAKLRMVIEESRRLSFLQLRNGA 216

  Fly   219 --FQDCEQQDMLQALCVALKRNQLLLGRIWRLEGDVGSYFTPTMLLLFLYNGLTILHMVNWAYIN 281
              .:.|...|.|:.:.....:.|.::|::..:.|..|         |..|:.. .|.:|..:|::
  Fly   217 FMTRCCYLSDQLEDIGEVQSQLQSMVGQLDEVFGMQG---------LMAYSEY-YLSIVGTSYMS 271

  Fly   282 KFLYDSCCQYERFLVCSTLLVNLLLPCLLSQRCINAYNCFPRIL--HK----------IRCTSAD 334
            ..:|.......:....::::|.:|:........:|..|.. |:|  ||          :..:|.|
  Fly   272 YSIYKYGPHNLKLSAKTSIIVCILITLFYLDALVNCNNML-RVLDHHKDFLGLLEERTVFASSLD 335

  Fly   335 PNFAMLTRGLREYSLQMEHLKLRFTCGGLFDINLKYFGGLLVTIFGYIIILIQFKVQ 391
               ..|........||:....|:....|:|.|.......:..::....|.||||.::
  Fly   336 ---IRLEESFESLQLQLARNPLKINVMGMFPITRGSTAAMCASVIVNSIFLIQFDME 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr98bNP_733213.1 7tm_7 13..391 CDD:285581 69/380 (18%)
Gr36bNP_724039.1 7tm_7 9..390 CDD:285581 69/382 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.