DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr98b and Gr59a

DIOPT Version :9

Sequence 1:NP_733213.1 Gene:Gr98b / 117327 FlyBaseID:FBgn0046887 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_726287.2 Gene:Gr59a / 117485 FlyBaseID:FBgn0045483 Length:367 Species:Drosophila melanogaster


Alignment Length:312 Identity:67/312 - (21%)
Similarity:110/312 - (35%) Gaps:96/312 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 RRLGGIYKDIADLEMDMDEASQCFGGQRQRFSFRFRMALCVGVWMILMVGSM---PRLTMTAMGP 170
            :|:|..| ::..:.:.|.......|..||....|....|...:::.|:..:.   .:|..||  .
  Fly     2 KRIGQAY-NVYAVFIGMTSYETMGGKFRQSRITRIYCLLINAIFLTLLPSAFWKSAKLLSTA--D 63

  Fly   171 FVSTLLKILTEFVMIMQQLKSLEYCV--FVLIIYELVLRLRRTLSQLQEEFQDCEQQDMLQALCV 233
            ::.:.::: |.::|          |.  :..|.|.|:.|.          ::|....| ||.:.:
  Fly    64 WMPSYMRV-TPYIM----------CTINYAAIAYTLISRC----------YRDAMLMD-LQRIVL 106

  Fly   234 ALKRNQL--------LLGRIWRLEGDVGSYFTPT------MLLLFLYNGLTILHMVNWAYINKFL 284
            .:.|..|        ||.|::.|:     .||.|      :|.:|:|.    ....||:.:    
  Fly   107 EVNREMLRTGKKMNSLLRRMFFLK-----TFTLTYSCLSYILAVFIYQ----WKAQNWSNL---- 158

  Fly   285 YDSCCQYERFLVCSTLLVNLLLPCLLSQRCINAYNCFPRILHKIR--------------CTSADP 335
                        |:.||||:.|..|.    :|.:..|..:.|..|              |.|.| 
  Fly   159 ------------CNGLLVNISLTILF----VNTFFYFTSLWHIARGYDFVNQQLNEIVACQSMD- 206

  Fly   336 NFAMLTRGLREY-SLQMEHLKLRFTCGGLFDINLKYFGGLLVTIFGYIIILI 386
                |.|..:|. .|...|..|.:|..   .||..|...:|...|.|.|..|
  Fly   207 ----LERKSKELRGLWALHRNLSYTAR---RINKHYGPQMLAMRFDYFIFSI 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr98bNP_733213.1 7tm_7 13..391 CDD:285581 67/312 (21%)
Gr59aNP_726287.2 7tm_7 7..363 CDD:285581 65/307 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.