DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr98b and Gr92a

DIOPT Version :9

Sequence 1:NP_733213.1 Gene:Gr98b / 117327 FlyBaseID:FBgn0046887 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_732489.2 Gene:Gr92a / 117473 FlyBaseID:FBgn0045471 Length:386 Species:Drosophila melanogaster


Alignment Length:423 Identity:72/423 - (17%)
Similarity:154/423 - (36%) Gaps:134/423 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 RWYLMTGYVFYATAIL---ATVFIVSYFNIIAIDEEVLEY---------NVSDFTRVMGNIQKSL 92
            |:....|.:|:.....   .||||.::...:.:...::.:         ::|..|..:..:...:
  Fly    23 RYAQFIGVIFFCLHTRKDDKTVFIRNWLKWLNVTHRIITFTRFFWVYIASISIKTNRVLQVLHGM 87

  Fly    93 YSIMAIANHLNMLINYRRLGG------------IYKDIADLEMDMDEASQCFGGQRQ-------- 137
            ..:::|.| :.:::.|....|            :::.::||   ....:..|||:|:        
  Fly    88 RLVLSIPN-VAVILCYHIFRGPEIIDLINQFLRLFRQVSDL---FKTKTPGFGGRRELILILLNL 148

  Fly   138 ----------------RFSFRFRMALCVGVWMI------LMVGSMPRLTM----TAMGPFVSTLL 176
                            .||:||.:......:::      :.:.|:..|::    :.:..:|.|.|
  Fly   149 ISFAHEQTYLWFTIRKGFSWRFLIDWWCDFYLVSATNIFIHINSIGYLSLGVLYSELNKYVYTNL 213

  Fly   177 KILTEFVMIMQQLKSLEYCVFVLIIYELVLRLRRTLSQLQEEFQDCEQQDMLQALCVALKRNQLL 241
            :|         ||:.|.       ......::||..::|::              |::|.|    
  Fly   214 RI---------QLQKLN-------TSGSKQKIRRVQNRLEK--------------CISLYR---- 244

  Fly   242 LGRIWRLEGDVGSYFTPTMLLLFLYNGLTI-LHMVNWA---YINKFLYDSCCQYERFLVCSTLLV 302
              .|:.........|.|.:.|..:|..|.| |...|.|   |:|.|::        :::....::
  Fly   245 --EIYHTSIMFHKLFVPLLFLALIYKVLLIALIGFNVAVEFYLNSFIF--------WILLGKHVL 299

  Fly   303 NLLLPCLLSQRCINAY-NC---FPRI--LHKIRCTSADPNFAMLTRGLREYSLQMEHLKL---RF 358
            :|.|..:..:..:|.: |.   |..:  |.|.: |:.|..|.              ||:|   |.
  Fly   300 DLFLVTVSVEGAVNQFLNIGMQFGNVGDLSKFQ-TTLDTLFL--------------HLRLGHFRV 349

  Fly   359 TCGGLFDINLKYFGGLLVTIFGYIIILIQFKVQ 391
            :..||||:....:...|..:...:..:.|:::|
  Fly   350 SILGLFDVTQMQYLQFLSALLSGLAFIAQYRMQ 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr98bNP_733213.1 7tm_7 13..391 CDD:285581 71/421 (17%)
Gr92aNP_732489.2 7tm_7 18..382 CDD:285581 71/421 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.