DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr98b and Gr39b

DIOPT Version :9

Sequence 1:NP_733213.1 Gene:Gr98b / 117327 FlyBaseID:FBgn0046887 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_724336.1 Gene:Gr39b / 117347 FlyBaseID:FBgn0041245 Length:369 Species:Drosophila melanogaster


Alignment Length:391 Identity:81/391 - (20%)
Similarity:159/391 - (40%) Gaps:68/391 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 HRRLRWYLMTGYVFYATAILATVFIVSYFNIIAIDEEVLEYNVSD--------FTRVMGNIQKSL 92
            |..|:::.:.|.|.::.:...:.|:...::.|.|....:.:.:|.        |..:|.|:...:
  Fly     6 HPYLKYFALLGLVPWSESCAQSKFVQKVYSAILIILNAVHFGISIYFPQSAELFLSLMVNVIVFV 70

  Fly    93 YSIMAI-ANHLNMLINYRRLGGIYKDIADLEMDMDEASQCFGGQRQRFSFRFRMALCVGVWMILM 156
            ..|:.: ...|.::::|.......:::..|.:.:....:...|:.:..|:...:||.:|    .:
  Fly    71 ARIVCVTVIILQVMVHYDDYFRFCREMKYLGLRLQCELKIHVGRLKWQSYAKILALGIG----FL 131

  Fly   157 VGSMPRLTMTAMGP---FVSTLLKIL---TEFVMIMQQLKSLEYCVFVLIIYELVLRLRRTLSQL 215
            |..:|.:.:...|.   |.|:||.||   .:||:::..::.|.:.|.:|.|     ||:..| :.
  Fly   132 VTVLPSIYVALSGSLLYFWSSLLSILIIRMQFVLVLLNVELLGHHVSLLGI-----RLQNVL-EC 190

  Fly   216 QEEFQDCEQQDMLQALC-----VALKRNQLLLGRIWRLEGDV-GSYFTPTMLLLFLYNGLTILHM 274
            .....:|........||     :|||::.:.|..::....|: |.....|.::||..:.:.|.  
  Fly   191 HLMGANCTLDGNANRLCSLEFLLALKQSHMQLHYLFTHFNDLFGWSILGTYVVLFSDSTVNIY-- 253

  Fly   275 VNW-------AYINKFLYDSCCQYERFLVCSTLLVNLLLPCLLSQRC------INAY----NCFP 322
              |       .|..|:||.:      |.|......|:|:.|...:.|      |.:|    :|.|
  Fly   254 --WTQQVLVEVYEYKYLYAT------FSVFVPSFFNILVFCRCGEFCQRQSVLIGSYLRNLSCHP 310

  Fly   323 RILHKIRCTSADPNFAMLTRGLREYSLQMEHLKLRFTCGGLFDINLKYFGGLLVTIFGYIIILIQ 387
            .|       ..:.::..|   |.|:.||:|...|.....|....:......:|.....|:|:|:|
  Fly   311 SI-------GRETSYKDL---LMEFILQVEQNVLAINAEGFMSTDNSLLMSILAAKVTYLIVLMQ 365

  Fly   388 F 388
            |
  Fly   366 F 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr98bNP_733213.1 7tm_7 13..391 CDD:285581 81/391 (21%)
Gr39bNP_724336.1 7tm_7 5..367 CDD:303125 81/391 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.