DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment clt and Nlg3

DIOPT Version :9

Sequence 1:NP_536784.1 Gene:clt / 117300 FlyBaseID:FBgn0000326 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_001036685.2 Gene:Nlg3 / 40912 FlyBaseID:FBgn0083963 Length:1159 Species:Drosophila melanogaster


Alignment Length:678 Identity:153/678 - (22%)
Similarity:243/678 - (35%) Gaps:208/678 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 GVLVGRQKKLVNGLEYNSFLGVPYAEPPVGELRFRSP---------RPLERF------------- 69
            ||:|....:.::.:|  ::.|:|||.||||.|||..|         :..:||             
  Fly   167 GVIVQLDGRHLDPVE--AYRGIPYASPPVGNLRFMPPVSAAMWSGVKKADRFSPVCPQRLPDIHN 229

  Fly    70 QKQELDCSKEGNVSYQRDPFTLEVAGSEDCLFLNVYAPKVKSTR--------------------- 113
            :...|:...:|.:.|.:.........|||||:||:|.|....:|                     
  Fly   230 ETAALERMPKGRLEYLKRLLPYLQNQSEDCLYLNIYVPIQVGSRDSSGSSSSSSAGSSSSGSGGS 294

  Fly   114 -------------------TPLPVMVWIHGGGFFFGNGNSDFHFPAKLMEQ--EVIVVTLNYRLG 157
                               ...||:|::||..:.:.:||.   :...::..  :::|||:|||||
  Fly   295 SSSSSSSSTSSSSAGSGSPAKYPVLVFVHGESYEWNSGNP---YDGSVLASYGQILVVTINYRLG 356

  Fly   158 ALGFLS--------LPEEGIHGNMGLKDQRLALEWVQENIASFNGDPNNVTLFGESAGGSSVH-- 212
            .||||:        ||     .|.||.|...||.|::||||:|.||||::||.|...|.:.||  
  Fly   357 VLGFLNANTDRYSKLP-----ANYGLMDIIAALHWLKENIAAFGGDPNSITLAGHGTGAACVHFL 416

  Fly   213 LHTFARHAKRLFHKAIMQSGTANMEWVFQNEAPAKTRRLAELLGGGDFGGDSKALLTFLQSEKAT 277
            :.:.|.....||::||:.||:....|...:. |||...:               :...:......
  Fly   417 ISSMAVPEGLLFNRAILMSGSGLAPWSLVSN-PAKYAAI---------------VAHHVNCASDL 465

  Fly   278 PTAILANTLK------VLSPDERRRHLPFAFKP----VVEDS--------SSPDRFLEQDIMELM 324
            |.|.|...|:      :||...|.....|||.|    ||.|.        .||           .
  Fly   466 PHAHLMKCLREKTLDQLLSVPIRPPEFGFAFGPSIDGVVIDGGDYVPPAPGSP-----------A 519

  Fly   325 HKKDCLGSMPVIMGYNSAEGLA-------------IVVKAK---QKLEAYEDDLARLVPRNLVL- 372
            .:.....|.....|.....|:|             ||:..|   .||..|  ||...|.|.... 
  Fly   520 AQAQAQASTAAGNGLGGEAGIAAAGGWGTPGQLENIVLMRKTAINKLSRY--DLMAGVTRAEAFF 582

  Fly   373 -----DPQ-APEAQEAASDIRAFFFNGQALSKENM----------------------DNLVDLFS 409
                 |.| ..||...:..::|:..|........:                      |..::..|
  Fly   583 SFNSGDVQYGIEADRRSRILKAYVRNTYTFHLNEIFATIVNEYTDWERPVQHPINIRDETLEALS 647

  Fly   410 DYHFSMDLQRAVEIHASCQTQSPLYFYRLDYVGGRNLYKKIFQNEDLRGVAHADDICYLF--QMA 472
            |........:.|::|::....|  |.|..||      ..:.......:|..|.:|:.|:|  .:.
  Fly   648 DAQVVAPAAQTVDLHSADHRNS--YLYVFDY------QTRFGDYPQRQGCIHGEDLPYIFGAPLV 704

  Fly   473 GDETEMNRD----DLMVTERLCEMWANFARDGKPSPIWKPVKKPHNG---------------EPI 518
            |......|:    ::.::|.:...|:||.|.|.|:   :.::..|..               |.:
  Fly   705 GGFNHFTRNYTKTEISLSEVVMFYWSNFVRTGNPN---EQMETEHGSRQERSRYKTIEWTAYESV 766

  Fly   519 QLDCLLIDRELKMCSNPDGERMDFWRSM 546
            ....|..|.:.|:.::....|:.||.::
  Fly   767 HKKYLNFDTKPKLKNHYRAHRLSFWLNL 794

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cltNP_536784.1 COesterase 22..543 CDD:278561 151/673 (22%)
Nlg3NP_001036685.2 COesterase 151..791 CDD:278561 151/673 (22%)
Aes <313..>410 CDD:223730 40/104 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.