DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment clt and Nrt

DIOPT Version :9

Sequence 1:NP_536784.1 Gene:clt / 117300 FlyBaseID:FBgn0000326 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_001189121.1 Gene:Nrt / 39873 FlyBaseID:FBgn0004108 Length:846 Species:Drosophila melanogaster


Alignment Length:433 Identity:110/433 - (25%)
Similarity:168/433 - (38%) Gaps:99/433 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 SFLGVPYAEPPVGELRFRSPRPLE----------RFQKQELDCSKE-GNVSYQRDPFTLEVAGSE 97
            :|.|:|||:|||..||::....::          :.....:.|::. ||.:         ..|.|
  Fly   380 AFRGIPYAKPPVDRLRWKPAELIDDINMCWNDTLQTHNSSVVCTQRLGNGT---------TVGDE 435

  Fly    98 DCLFLNVYAPKVKSTRTPLPVMVWIHGGGFFFGNGNSDFHFPAKL-MEQEVIVVTLNYRLGALGF 161
            |||:|:|..|.|: ...||||:|.| |.....|.........|:. ...:||.|..|:|||..||
  Fly   436 DCLYLDVVTPHVR-YNNPLPVVVLI-GAESLAGPSPGILRPSARYSRSHDVIFVRPNFRLGVFGF 498

  Fly   162 LSLP--EEGIH----GNMGLKDQRLALEWVQENIASFNGDPNNVTLFGESAGGSSVHLHTFARHA 220
            |:|.  .:..|    ||..|.|....|.|::.||..|.|||.:|||.|..||.:.|.|...::..
  Fly   499 LALDALTKEAHPPTSGNYALTDIIAVLNWIKLNIVHFGGDPQSVTLLGHRAGATLVTLLVNSQKV 563

  Fly   221 KRLFHKAIMQSGTANMEWVFQNEAPAKTRRLAELLGGGDFGGDSKALLTFLQSEK---ATPTAIL 282
            |.|:.:|...||:|.:.....:|:..:..:|...|...|.     ..|....||:   |||...|
  Fly   564 KGLYTRAWASSGSAILPGKPLSESGKQNEQLMATLECADI-----QCLREASSERLWAATPDTWL 623

  Fly   283 ANTLKVLSPDERRRHLPFAFKPVVEDSSSPDR----FLEQDIMELMH-----KKDCLGSMPV-IM 337
                          |.|.......|.::|..|    .|:.|:: ..|     |::.....|| :|
  Fly   624 --------------HFPVDLPQPQEANASGSRHEWLVLDGDVV-FEHPSDTWKREQANDKPVLVM 673

  Fly   338 GYNSAEGLAIVVKAKQKLEAYEDDLARLVPRNLVLDPQAPEAQEAASDIRAFFFNGQ-------- 394
            |..:.             ||:.:.|..|            .|.....::||:..|.|        
  Fly   674 GATAH-------------EAHTEKLREL------------HANWTREEVRAYLENSQIGALGLTD 713

  Fly   395 -ALSKENMDNLVDLFSDYHFSMDLQRAVEIHASCQTQSPLYFY 436
             .:.|.|..:...|.|   ...|::....:..:.:.|..:.||
  Fly   714 EVIEKYNASSYASLVS---IISDIRSVCPLLTNARQQPSVPFY 753

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cltNP_536784.1 COesterase 22..543 CDD:278561 110/433 (25%)
NrtNP_001189121.1 Abhydrolase 362..832 CDD:304388 110/433 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11559
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.