DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment clt and CG3841

DIOPT Version :9

Sequence 1:NP_536784.1 Gene:clt / 117300 FlyBaseID:FBgn0000326 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_001188759.1 Gene:CG3841 / 34278 FlyBaseID:FBgn0032131 Length:564 Species:Drosophila melanogaster


Alignment Length:516 Identity:159/516 - (30%)
Similarity:239/516 - (46%) Gaps:91/516 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 SFLGVPYAEPPVGELRFRSPRPL-----ERFQ--KQELDCSKEGNVSYQRDPFTLEVAGSEDCLF 101
            :|.|:.||:.|||:|||.:|.|.     |.|.  ...|.|.:.|.||..          |||||.
  Fly    53 AFRGIRYAQSPVGQLRFANPVPETSWGDEVFNATSDSLVCPQPGVVSLM----------SEDCLK 107

  Fly   102 LNVYAPKVKSTRTPLPVMVWIHGGGFFFGNGNSDFHF-PAKLMEQEVIVVTLNYRLGALGFLSLP 165
            :||:   .||.....||||:||||....|:|:|.:.. |..|::|:|:.|..|||||||||||..
  Fly   108 INVF---TKSFEDKFPVMVYIHGGANVLGSGHSSYEAGPQYLLDQDVVFVAFNYRLGALGFLSTN 169

  Fly   166 EEGIHGNMGLKDQRLALEWVQENIASFNGDPNNVTLFGESAGGSSVHLHTFARHAKRLFHKAIMQ 230
            .....||.|..||.:|||||:::|:.|.|||..||:.|.|||..:|.||..:..:..|||:||:.
  Fly   170 SSETKGNFGFLDQVMALEWVRDHISHFGGDPELVTIIGISAGSMAVSLHLASPLSAGLFHRAILM 234

  Fly   231 SGTA-------NMEWVFQNEAPAKTRRLAELLGGGDFGGDSKALLTFLQSE---------KATPT 279
            ||:|       |:.|         ||:||..||...:  |...::..|::|         ||..|
  Fly   235 SGSATNHFDIDNLFW---------TRKLARELGCPMY--DPTDVVECLRNETWTRIVEVCKAWET 288

  Fly   280 AILANTLKVLSPDERRRHLPFAFKPVVEDSSSPDRFLEQDIMELMHKKDCLGSMPVIMGYNSAE- 343
            ..|.|.......|                    ..||.....||: |:.....:|:::.:.:.| 
  Fly   289 YQLVNMKWNYEID--------------------GHFLHNHPTELI-KEGNFNKVPLLISFTANEF 332

  Fly   344 --GLAIVVKAKQKLEAYEDDLARLVPRNLVLDPQAPEAQEAASDIRAFFF--NGQALSKENMDNL 404
              ...:.::.:..|..:..:.....|...:....|    :....::.|:.  |...::.||::|.
  Fly   333 DYNANVHLENQHLLHDFASNFVDYAPELFLYRHDA----QIGEKLKDFYLGDNTTEINSENIENF 393

  Fly   405 VDLFSDYHFSMDLQRAVEIHASCQTQSPLYFYRLDYVGGRNLYKKIFQNEDLRGVAHADDICYLF 469
            ..:|||.:....:.|.|:: ||..|  |:|:.|:||||.::|...:.......||.||||:.|:.
  Fly   394 GQIFSDAYIGHGVHRLVQL-ASHFT--PVYYTRMDYVGDQSLSAPLNGENKPVGVGHADDLHYVL 455

  Fly   470 --QMAGDETEMNRDDLMVTERLCEMWANFARDGKP---SPIWKP-----VKKPHNGEPIQL 520
              ...|.....|..|:.:.|||...:.:||:.|.|   :.||.|     :|..:||...|:
  Fly   456 PGYWYGPLMAANDSDVFMMERLTSWFTHFAKTGTPLNSTDIWPPCNSTVLKMLYNGVVTQV 516

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cltNP_536784.1 COesterase 22..543 CDD:278561 159/516 (31%)
CG3841NP_001188759.1 COesterase 27..528 CDD:278561 159/516 (31%)
Aes <116..>235 CDD:223730 56/118 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 98 1.000 Domainoid score I1867
eggNOG 1 0.900 - - E2759_KOG1516
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I1664
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000017
OrthoInspector 1 1.000 - - otm46967
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X33
76.860

Return to query results.
Submit another query.