DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment clt and Aadacl3

DIOPT Version :10

Sequence 1:NP_536784.1 Gene:clt / 117300 FlyBaseID:FBgn0000326 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_001078972.1 Gene:Aadacl3 / 230883 MGIID:2685281 Length:408 Species:Mus musculus


Alignment Length:131 Identity:30/131 - (22%)
Similarity:59/131 - (45%) Gaps:19/131 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 QRDPFTLEVAGSEDCLF----LNVYAPKVKSTRTPLPVMVWIHGGGFFFGNGNSDFHFPAKLMEQ 145
            :|||..:    .:|..|    :.:|.|| |.:..|...:::.||||...|:..:......:|.::
Mouse    83 KRDPDVV----VKDLHFGTIPVKLYKPK-KPSSIPRLGIIFFHGGGTIIGSLRTHNSICLRLSKE 142

  Fly   146 -EVIVVTLNYRLGALGFLSLPEEGIHGNMGLKDQRLALEWVQENIASFNGDPNNVTLFGESAGGS 209
             :.:||::.||...:....:.::         |..:|.....|::..:..||..|...|:|.||:
Mouse   143 CDSVVVSVGYRKSPMYKYPVMKD---------DCVVATTHFLESLDVYGVDPARVVTCGDSVGGT 198

  Fly   210 S 210
            :
Mouse   199 A 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cltNP_536784.1 alpha/beta hydrolases 22..543 CDD:473884 30/131 (23%)
Aadacl3NP_001078972.1 Abhydrolase_3 116..379 CDD:400284 20/93 (22%)
Involved in the stabilization of the negatively charged intermediate by the formation of the oxyanion hole. /evidence=ECO:0000250|UniProtKB:Q5NUF3 120..122 1/1 (100%)

Return to query results.
Submit another query.