DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment clt and CES5A

DIOPT Version :9

Sequence 1:NP_536784.1 Gene:clt / 117300 FlyBaseID:FBgn0000326 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_001177087.1 Gene:CES5A / 221223 HGNCID:26459 Length:604 Species:Homo sapiens


Alignment Length:558 Identity:165/558 - (29%)
Similarity:259/558 - (46%) Gaps:93/558 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 GVLVGRQKKLVNG-LEYNSFLGVPYAEPPVGELRFRSPRPLERFQKQELDCSKEGNVSYQRDPFT 90
            |.:.|:|..::.. :..|.|||||:|.||:|.|||.:|:|...:.... :.:...|:..|...:.
Human    67 GWIQGKQVTVLGSPVPVNVFLGVPFAAPPLGSLRFTNPQPASPWDNLR-EATSYPNLCLQNSEWL 130

  Fly    91 L-----------EVAGSEDCLFLNVYAPKVKSTRTPLPVMVWIHGGGFFFGNGNSDFHFPAKLME 144
            |           :...|||||:||:|||....|.:.|||:||..||.|..|:. |.|...|....
Human   131 LLDQHMLKVHYPKFGVSEDCLYLNIYAPAHADTGSKLPVLVWFPGGAFKTGSA-SIFDGSALAAY 194

  Fly   145 QEVIVVTLNYRLGALGFLSLPEEGIHGNMGLKDQRLALEWVQENIASFNGDPNNVTLFGESAGGS 209
            ::|:||.:.||||..||.:..::...||...|||..||.|||:||..|.|||::||:||||||..
Human   195 EDVLVVVVQYRLGIFGFFTTWDQHAPGNWAFKDQVAALSWVQKNIEFFGGDPSSVTIFGESAGAI 259

  Fly   210 SVHLHTFARHAKRLFHKAIMQSGTANMEWV--FQNEAPAKTRRLAELLGGGDFGGDSKALLTFLQ 272
            ||.....:..||.|||||||:||.|.:.::  ...|.....:.:|...|..  ..||:|||..|:
Human   260 SVSSLILSPMAKGLFHKAIMESGVAIIPYLEAHDYEKSEDLQVVAHFCGNN--ASDSEALLRCLR 322

  Fly   273 SEKATPTAILANTLKVLSPDERRRHLPFAFKPVVEDSSSPDRFLEQDIMELMHKKDCLGSMPVIM 337
            ::.:.....|:...|             :|..||:.:     |...:.::|:.:| ...::|.|:
Human   323 TKPSKELLTLSQKTK-------------SFTRVVDGA-----FFPNEPLDLLSQK-AFKAIPSII 368

  Fly   338 GYNSAE-GLAIVVK-AKQKLEAYEDDLARLVPRNLVLDPQAPEAQEAASDIRAFFFNGQALSKEN 400
            |.|:.| |..:.:| |.:.|......||..:.:|::..|  |:.....::  .:|.:..:|: |.
Human   369 GVNNHECGFLLPMKEAPEILSGSNKSLALHLIQNILHIP--PQYLHLVAN--EYFHDKHSLT-EI 428

  Fly   401 MDNLVDLFSDYHFSMDLQRAVEIHASCQTQSPLYFYRLDYVGGRNL------YKKIFQNEDLRGV 459
            .|:|:||..|..|.:........|.  ...:|:|||..     |:.      .|..|...|    
Human   429 RDSLLDLLGDVFFVVPALITARYHR--DAGAPVYFYEF-----RHRPQCFEDTKPAFVKAD---- 482

  Fly   460 AHADDICYLFQ---MAGD------ETEMNRDDLMVTERLCEMWANFARDGKPSPIWKPVKKPHNG 515
             |||::.::|.   :.||      .||   ::.:::.::.:.||.|||.|.|           ||
Human   483 -HADEVRFVFGGAFLKGDIVMFEGATE---EEKLLSRKMMKYWATFARTGNP-----------NG 532

  Fly   516 EPIQL--------DCLLIDRELKMCSNPDGERMDFWRS 545
            ..:.|        ..|.:|..:.:.......|:|||.|
Human   533 NDLSLWPAYNLTEQYLQLDLNMSLGQRLKEPRVDFWTS 570

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cltNP_536784.1 COesterase 22..543 CDD:278561 162/554 (29%)
CES5ANP_001177087.1 COesterase 56..568 CDD:278561 162/554 (29%)
Aes <155..>258 CDD:223730 48/103 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 216 1.000 Inparanoid score I3612
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000017
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11559
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.