DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment clt and Nlgn3

DIOPT Version :9

Sequence 1:NP_536784.1 Gene:clt / 117300 FlyBaseID:FBgn0000326 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_599163.2 Gene:Nlgn3 / 171297 RGDID:621119 Length:848 Species:Rattus norvegicus


Alignment Length:613 Identity:166/613 - (27%)
Similarity:242/613 - (39%) Gaps:199/613 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 TRFCSSMKVKVPVKQGVLVGRQKKLVNGLEYNSFLGVPYAEPPVGELRFRSPRP----------- 65
            |.|......:||:...:|.          ..:.:||||||.||:||.||..|.|           
  Rat    46 THFGKLRGARVPLPSEILG----------PVDQYLGVPYAAPPIGEKRFLPPEPPPSWSGIRNAT 100

  Fly    66 ------------------LERFQKQELDCSKEGNVSYQRDPFTLEVAGSEDCLFLNVYAP----- 107
                              |..:....||..    .:|.::|       :||||:||||.|     
  Rat   101 HFPPVCPQNIHTAVPEVMLPVWFTANLDIV----ATYIQEP-------NEDCLYLNVYVPTEDVK 154

  Fly   108 --KVKSTRTP-----------------------------------LPVMVWIHGGGFFFGNGNSD 135
              ..:..|.|                                   .||||:||||.:..|.||. 
  Rat   155 RISKECARKPNKKICRKGGSGAKKQGEDLADNDGDEDEDIRDSGAKPVMVYIHGGSYMEGTGNM- 218

  Fly   136 FHFPAKLMEQ--EVIVVTLNYRLGALGFLSLPEEGIHGNMGLKDQRLALEWVQENIASFNGDPNN 198
              ....::..  .|||:|||||:|.|||||..::...||.||.||..||.||.||||.|.|||..
  Rat   219 --IDGSVLASYGNVIVITLNYRVGVLGFLSTGDQAAKGNYGLLDQIQALRWVSENIAFFGGDPRR 281

  Fly   199 VTLFGESAGGSSVHLHTFARHAKRLFHKAIMQSGTANMEWVFQNEAPAK-TRRLAELLGGGDFGG 262
            :|:||...|.|.|.|.|.:.|::.||.:||:|||:|...|.. |..|.| |..||:.:|....  
  Rat   282 ITVFGSGIGASCVSLLTLSHHSEGLFQRAIIQSGSALSSWAV-NYQPVKYTSLLADKVGCNVL-- 343

  Fly   263 DSKALLTFLQSEKATPTAILANTLKVLSPDERRRHLPFAFKPVVEDSSSPD---------RFLEQ 318
            |:..::..|:.:.|.         :::..|.:......||.||::....||         .||..
  Rat   344 DTVDMVDCLRQKSAK---------ELVEQDIQPARYHVAFGPVIDGDVIPDDPEILMEQGEFLNY 399

  Fly   319 DIMELMHKKDCLGSMPVIMGYNSAEGLAIVVKAKQKLEAYEDDLARLVPRNLVLDPQ-------- 375
            |||               :|.|..|||..|                    ..|:||:        
  Rat   400 DIM---------------LGVNQGEGLKFV--------------------EGVVDPEDGVSGTDF 429

  Fly   376 -------------APEAQEAASDIRAFFFNGQALSKENMD----NLVDLFSDYHFSMDLQRAVEI 423
                         .||.::...:...|.:...| .::|.:    .||.||:|:.:........::
  Rat   430 DYSVSNFVDNLYGYPEGKDTLRETIKFMYTDWA-DRDNPETRRKTLVALFTDHQWVEPSVVTADL 493

  Fly   424 HASCQTQSPLYFYRLDYVGGRNLYKKIFQNEDLRGVAHADDICYLF--QMAGDETEM-----NRD 481
            ||  :..||.|||.. |...::|.|..:.:     .||.|::.|:|  .|.| .|::     :::
  Rat   494 HA--RYGSPTYFYAF-YHHCQSLMKPAWSD-----AAHGDEVPYVFGVPMVG-PTDLFPCNFSKN 549

  Fly   482 DLMVTERLCEMWANFARDGKPSPIWKPV 509
            |:|::..:...|.|||:.|.|:   |||
  Rat   550 DVMLSAVVMTYWTNFAKTGDPN---KPV 574

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cltNP_536784.1 COesterase 22..543 CDD:278561 164/603 (27%)
Nlgn3NP_599163.2 COesterase 40..624 CDD:395084 166/613 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 169..195 0/25 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 645..691
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.