DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment clt and LOC1278331

DIOPT Version :10

Sequence 1:NP_536784.1 Gene:clt / 117300 FlyBaseID:FBgn0000326 Length:562 Species:Drosophila melanogaster
Sequence 2:XP_317954.5 Gene:LOC1278331 / 1278331 VectorBaseID:AGAMI1_014970 Length:147 Species:Anopheles gambiae


Alignment Length:33 Identity:14/33 - (42%)
Similarity:17/33 - (51%) Gaps:1/33 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 AKPQVNTTS-TTVKKKGPGMPPPPMIPGKHNMD 129
            |..|.:||| .|...:||....||..||..|:|
Mosquito    15 ASAQDSTTSWQTGATQGPTPSTPPPTPGGSNVD 47

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cltNP_536784.1 alpha/beta hydrolases 22..543 CDD:473884 14/33 (42%)
LOC1278331XP_317954.5 None

Return to query results.
Submit another query.