DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment clt and AADACL3

DIOPT Version :10

Sequence 1:NP_536784.1 Gene:clt / 117300 FlyBaseID:FBgn0000326 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_001096640.2 Gene:AADACL3 / 126767 HGNCID:32037 Length:407 Species:Homo sapiens


Alignment Length:108 Identity:29/108 - (26%)
Similarity:54/108 - (50%) Gaps:9/108 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 LNVYAPKVKSTRTPLPVMVWIHGGGFFFGNGNSDFHFPAKLMEQEVIVVTLNYRLGALGFLSLPE 166
            :.:|.||. ||.|..|.:|:.||||...|:..:.....::|.::...||.      |:|:..||:
Human    99 VKLYQPKA-STCTLKPGIVYYHGGGGVMGSLKTHHGICSRLCKESDSVVL------AVGYRKLPK 156

  Fly   167 EGIHGNMGLKDQRLALEWVQENIASFNGDPNNVTLFGESAGGS 209
            ...  .:.::|..:|.....:::.::..||..|.:.|:|.||:
Human   157 HKF--PVPVRDCLVATIHFLKSLDAYGVDPARVVVCGDSFGGA 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cltNP_536784.1 alpha/beta hydrolases 22..543 CDD:473884 29/108 (27%)
AADACL3NP_001096640.2 Abhydrolase_3 115..378 CDD:400284 22/91 (24%)
Involved in the stabilization of the negatively charged intermediate by the formation of the oxyanion hole. /evidence=ECO:0000250|UniProtKB:Q5NUF3 119..121 1/1 (100%)

Return to query results.
Submit another query.