DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment clt and Ache

DIOPT Version :9

Sequence 1:NP_536784.1 Gene:clt / 117300 FlyBaseID:FBgn0000326 Length:562 Species:Drosophila melanogaster
Sequence 2:XP_036020624.1 Gene:Ache / 11423 MGIID:87876 Length:616 Species:Mus musculus


Alignment Length:531 Identity:174/531 - (32%)
Similarity:257/531 - (48%) Gaps:82/531 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 VPVKQGVLVGRQKKLVNGLEYNSFLGVPYAEPPVGELRFRSPRPLERFQKQELDCSKEGNVSYQR 86
            |.|:.|.|.|.:.|...| ..::|||:|:||||||..||..|.| :|.....||.:...||.||.
Mouse    41 VRVRGGQLRGIRLKAPGG-PVSAFLGIPFAEPPVGSRRFMPPEP-KRPWSGVLDATTFQNVCYQY 103

  Fly    87 -DPFTLEVAG----------SEDCLFLNVYAPKVKSTRTPLPVMVWIHGGGFFFGNGNSDFHFPA 140
             |.......|          |||||:|||:.|..:.. :|.||::||:||||:.|..:.|.:...
Mouse   104 VDTLYPGFEGTEMWNPNRELSEDCLYLNVWTPYPRPA-SPTPVLIWIYGGGFYSGAASLDVYDGR 167

  Fly   141 KLMEQE-VIVVTLNYRLGALGFLSLP-EEGIHGNMGLKDQRLALEWVQENIASFNGDPNNVTLFG 203
            .|.:.| .::|::|||:|..|||:|| .....||:||.||||||:|||||||:|.|||.:|||||
Mouse   168 FLAQVEGAVLVSMNYRVGTFGFLALPGSREAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFG 232

  Fly   204 ESAGGSSVHLHTFARHAKRLFHKAIMQSGTANMEW--VFQNEAPAKTRRLAELLG--GGDFGGDS 264
            ||||.:||.:|..:..::.|||:|::||||.|..|  |...||..:...||.|:|  .|..||:.
Mouse   233 ESAGAASVGMHILSLPSRSLFHRAVLQSGTPNGPWATVSAGEARRRATLLARLVGCPPGGAGGND 297

  Fly   265 KALLTFLQSEKATPTAILANTLKVLSPDERRRHLPFAFKPVVED---SSSPDRFLEQ-DIMELMH 325
            ..|:..|::..|..  ::.:...||..:...|   |:|.|||:.   |.:|:..:.. |..:|. 
Mouse   298 TELIACLRTRPAQD--LVDHEWHVLPQESIFR---FSFVPVVDGDFLSDTPEALINTGDFQDLQ- 356

  Fly   326 KKDCLGSMPVIMGYNSAEGLAIVVKAKQKLEAYEDDLARLVPRNLVLDP---QAPEAQEAASDIR 387
                     |::|....||...:|..   :..:..|...|:.|...|..   ..|:|.:.|::..
Mouse   357 ---------VLVGVVKDEGSYFLVYG---VPGFSKDNESLISRAQFLAGVRIGVPQASDLAAEAV 409

  Fly   388 AFFFNGQALSKENMDNLVDLFS----DYHFSMDL-QRAVEIHASCQTQSPLYFYRLDYVGGRNLY 447
            ...:. ..|..|:..:|.|..|    |::....: |.|..:.|.                |..:|
Mouse   410 VLHYT-DWLHPEDPTHLRDAMSAVVGDHNVVCPVAQLAGRLAAQ----------------GARVY 457

  Fly   448 KKIFQNED-------LRGVAHADDICYLFQMAGDET-EMNRDDLMVTERLCEMWANFARDGKP-- 502
            ..||::..       ..||.|..:|.::|.:..|.: ....::.:..:||.:.|.||||.|.|  
Mouse   458 AYIFEHRASTLTWPLWMGVPHGYEIEFIFGLPLDPSLNYTTEERIFAQRLMKYWTNFARTGDPND 522

  Fly   503 -----SPIWKP 508
                 ||.|.|
Mouse   523 PRDSKSPQWPP 533

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cltNP_536784.1 COesterase 22..543 CDD:278561 174/531 (33%)
AcheXP_036020624.1 COesterase 37..563 CDD:395084 174/531 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000017
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.