DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dsp1 and TOX

DIOPT Version :9

Sequence 1:NP_001138203.1 Gene:Dsp1 / 117294 FlyBaseID:FBgn0278608 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_055544.1 Gene:TOX / 9760 HGNCID:18988 Length:526 Species:Homo sapiens


Alignment Length:291 Identity:67/291 - (23%)
Similarity:103/291 - (35%) Gaps:85/291 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 GSQWWYSAANQGQVDANTAAQLQHQQQQQQQQQQQQQQQHQQQQQMQQQQQQ---------QNV- 167
            |:|  ||:..|       .|.::.:.|....:||.....|.|...:.|.|..         .|| 
Human   146 GTQ--YSSHPQ-------MAAMRPRGQPADIRQQPGMMPHGQLTTINQSQLSAQLGLNMGGSNVP 201

  Fly   168 INSASPMSRVKADAKPRGRMTAYAYFVQTCREEHKKKHPDETVIFAEFSRKCAERWKTMVDKEKK 232
            .||.||.....|...|...:                 |.||           .:....:...||:
Human   202 HNSPSPPGSKSATPSPSSSV-----------------HEDE-----------GDDTSKINGGEKR 238

  Fly   233 RFHEMAEKDKQRYEAEMQNYVPPKGAVVGRGKKRKQIKDPNAPKRSLSAFFWFCNDERNKVKALN 297
            ...:|.:|.|           .||       ||:|  ||||.|::.:||:..|..|.:..:|..|
Human   239 PASDMGKKPK-----------TPK-------KKKK--KDPNEPQKPVSAYALFFRDTQAAIKGQN 283

  Fly   298 PEFGVGDIAKELGRKWSDVDPEVKQKYESMAERDKARYEREMTEYKTS----------------- 345
            |....|:::|.:...|..:..|.||.|:...|..|..|.:::..|:.|                 
Human   284 PNATFGEVSKIVASMWDGLGEEQKQVYKKKTEAAKKEYLKQLAAYRASLVSKSYSEPVDVKTSQP 348

  Fly   346 GKIAMSAPSMQASMQAQAQKAALLAAAAQQQ 376
            .::..|.||:... .:||..|..|::...||
Human   349 PQLINSKPSVFHG-PSQAHSALYLSSHYHQQ 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dsp1NP_001138203.1 HMG-box 182..252 CDD:294061 9/69 (13%)
HMGB-UBF_HMG-box 275..339 CDD:238686 18/63 (29%)
TOXNP_055544.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 138..178 10/40 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 192..264 26/119 (22%)
Nuclear localization signal. /evidence=ECO:0000255 237..256 9/38 (24%)
NHP6B <257..>360 CDD:227935 26/102 (25%)
HMG-box 261..>310 CDD:238037 14/48 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.