DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dsp1 and Hmgb2

DIOPT Version :9

Sequence 1:NP_001138203.1 Gene:Dsp1 / 117294 FlyBaseID:FBgn0278608 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001350372.1 Gene:Hmgb2 / 97165 MGIID:96157 Length:210 Species:Mus musculus


Alignment Length:216 Identity:101/216 - (46%)
Similarity:142/216 - (65%) Gaps:16/216 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 KPRGRMTAYAYFVQTCREEHKKKHPDETVIFAEFSRKCAERWKTMVDKEKKRFHEMAEKDKQRYE 246
            ||||:|::||:|||||||||||||||.:|.|||||:||:||||||..|||.:|.::|:.||.||:
Mouse     8 KPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDLAKSDKARYD 72

  Fly   247 AEMQNYVPPKGAVVGRGKKRKQIKDPNAPKRSLSAFFWFCNDERNKVKALNPEFGVGDIAKELGR 311
            .||:|||||||.  .:|||    ||||||||..||||.||::.|.|:|..:|...:||.||:||.
Mouse    73 REMKNYVPPKGD--KKGKK----KDPNAPKRPPSAFFLFCSENRPKIKIEHPGLSIGDTAKKLGE 131

  Fly   312 KWSDVDPEVKQKYESMAERDKARYEREMTEYKTSGK--IAMSAPSMQASMQAQAQKAALLAAAAQ 374
            .||:...:.||.||..|.:.|.:||:::..|:..||  .....|......:.:.:        .:
Mouse   132 MWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGRPTGSKKKNE--------PE 188

  Fly   375 QQHQQLEEQHDDDDGDGDDDE 395
            .:.::.||:.::||.:.::||
Mouse   189 DEEEEEEEEEEEDDEEEEEDE 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dsp1NP_001138203.1 HMG-box 182..252 CDD:294061 47/69 (68%)
HMGB-UBF_HMG-box 275..339 CDD:238686 29/63 (46%)
Hmgb2NP_001350372.1 HMG-box 7..78 CDD:320749 47/69 (68%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 71..102 22/36 (61%)
HMG_box 95..162 CDD:278906 29/66 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 162..210 10/56 (18%)
Required for chemotactic activity. /evidence=ECO:0000250|UniProtKB:P26583 165..180 3/14 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 116 1.000 Domainoid score I5930
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37582
Inparanoid 1 1.050 213 1.000 Inparanoid score I3622
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000133
OrthoInspector 1 1.000 - - otm43054
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48112
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3288
SonicParanoid 1 1.000 - - X111
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.990

Return to query results.
Submit another query.