DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dsp1 and NHP6B

DIOPT Version :9

Sequence 1:NP_001138203.1 Gene:Dsp1 / 117294 FlyBaseID:FBgn0278608 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_009647.2 Gene:NHP6B / 852386 SGDID:S000002157 Length:99 Species:Saccharomyces cerevisiae


Alignment Length:84 Identity:38/84 - (45%)
Similarity:53/84 - (63%) Gaps:2/84 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   264 KKR--KQIKDPNAPKRSLSAFFWFCNDERNKVKALNPEFGVGDIAKELGRKWSDVDPEVKQKYES 326
            |||  ::.||||||||.|||:.:|.|:.|:.|::.||:...|.:.:.||.:|..:..|.||.|||
Yeast    14 KKRTTRRKKDPNAPKRGLSAYMFFANENRDIVRSENPDVTFGQVGRILGERWKALTAEEKQPYES 78

  Fly   327 MAERDKARYEREMTEYKTS 345
            .|:.||.|||.|...|..:
Yeast    79 KAQADKKRYESEKELYNAT 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dsp1NP_001138203.1 HMG-box 182..252 CDD:294061
HMGB-UBF_HMG-box 275..339 CDD:238686 28/63 (44%)
NHP6BNP_009647.2 NHP6B 1..>99 CDD:227935 38/84 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 72 1.000 Domainoid score I2214
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000133
OrthoInspector 1 1.000 - - otm46726
orthoMCL 1 0.900 - - OOG6_100324
Panther 1 1.100 - - LDO PTHR48112
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3288
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.840

Return to query results.
Submit another query.