DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dsp1 and HMO1

DIOPT Version :9

Sequence 1:NP_001138203.1 Gene:Dsp1 / 117294 FlyBaseID:FBgn0278608 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_010459.1 Gene:HMO1 / 851754 SGDID:S000002581 Length:246 Species:Saccharomyces cerevisiae


Alignment Length:230 Identity:50/230 - (21%)
Similarity:101/230 - (43%) Gaps:49/230 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   202 KKKHPDETVIFA--EFSRKCAERWKTMVDKEKKRFHEMAEKDKQRYEA----------------- 247
            |.|...::::.:  |.|:...:...::||    .::.:.:.::::.||                 
Yeast     8 KLKSAKDSLVSSLFELSKAANQTASSIVD----FYNAIGDDEEEKIEAFTTLTESLQTLTSGVNH 68

  Fly   248 ------EMQNYV-PPKGAVVG---RGKKRKQIKDPNAPKRSLSAFFWFCNDERNKV-----KALN 297
                  |:.|.: ..|.|::.   :..:||..:||||||:.|:.||.:....|.::     ||..
Yeast    69 LHGISSELVNPIDDDKDAIIAAPVKAVRRKIERDPNAPKKPLTVFFAYSAYVRQELREDRQKAGL 133

  Fly   298 PEFGVGDIAKELGRKWSDVDPEVKQKYESMAERDKARYEREMTEYKTSGKIAMSAPSMQASMQAQ 362
            |.....:|.:|:.:||.::....|:|::.....:...|:||.::|..:.|.....|   ||::..
Yeast   134 PPLSSTEITQEISKKWKELSDNEKEKWKQAYNVELENYQREKSKYLEAKKNGTLPP---ASLENG 195

  Fly   363 AQKAAL-----LAAAAQQQHQQLEEQHDDDDGDGD 392
            ...|.:     |..||:   ..:|::..||||..:
Yeast   196 PTHAPVPIPFSLQHAAE---PPVEKRPHDDDGSSE 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dsp1NP_001138203.1 HMG-box 182..252 CDD:294061 9/74 (12%)
HMGB-UBF_HMG-box 275..339 CDD:238686 17/68 (25%)
HMO1NP_010459.1 NHP6B 36..246 CDD:227935 45/202 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48112
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.