DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dsp1 and NHP10

DIOPT Version :9

Sequence 1:NP_001138203.1 Gene:Dsp1 / 117294 FlyBaseID:FBgn0278608 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_010282.3 Gene:NHP10 / 851562 SGDID:S000002160 Length:203 Species:Saccharomyces cerevisiae


Alignment Length:219 Identity:44/219 - (20%)
Similarity:91/219 - (41%) Gaps:50/219 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   200 EHKKKH----PDETVIFAEFSRKCAERWKTMVDKEKKRFHEMAEKDKQRYEAEMQ-NYVPPKGAV 259
            |.||:.    .|:.|:..    ...:|.:..|.:.|..:..:.|:.:.|.|.:.: |...|...:
Yeast     4 EEKKRRLEELKDQNVVLG----LAIQRSRLSVKRLKLEYGVLLERLESRIELDPELNCEDPLPTL 64

  Fly   260 VG-----------RGK-KRKQIK--DPNAPKRSLSAFFWFCNDERNKVKALNPEFGVGDIAKELG 310
            ..           :.| ||.::|  |||.|||..:|:..:|...:.:::    :.|..|:.::|.
Yeast    65 ASFKQELLTKPFRKSKTKRHKVKERDPNMPKRPTNAYLLYCEMNKERIR----QNGSLDVTRDLA 125

  Fly   311 RKWSDVDPEVKQKYESMAERDKARYEREMTEYKTSGKIAMSAPSMQASMQAQAQKAALLAAAAQQ 375
            ..|.:::.:.::.|..:...|:.||:.||..|  :.||        :::.|...|        ::
Yeast   126 EGWKNLNEQDRKPYYKLYSEDRERYQMEMEIY--NKKI--------SNIDADDDK--------EE 172

  Fly   376 QHQQLEEQHDDD-----DGDGDDD 394
            ..|:::...:..     |..|.:|
Yeast   173 NEQKIKNNEEGSSTKVADSKGGED 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dsp1NP_001138203.1 HMG-box 182..252 CDD:294061 11/56 (20%)
HMGB-UBF_HMG-box 275..339 CDD:238686 13/63 (21%)
NHP10NP_010282.3 NHP6B 24..203 CDD:227935 39/195 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000133
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48112
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.