DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dsp1 and HMGB3

DIOPT Version :9

Sequence 1:NP_001138203.1 Gene:Dsp1 / 117294 FlyBaseID:FBgn0278608 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001031075.1 Gene:HMGB3 / 838659 AraportID:AT1G20696 Length:147 Species:Arabidopsis thaliana


Alignment Length:116 Identity:37/116 - (31%)
Similarity:56/116 - (48%) Gaps:11/116 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   254 PPKGAVVGRGKKRKQIKDPNAPKRSLSAFFWFCNDERNKVKALNPE-FGVGDIAKELGRKWSDVD 317
            |.|||       :...||||.|||..||||.|..|.|...|..:|: ..|..:.|..|.||..:.
plant    21 PAKGA-------KGAAKDPNKPKRPSSAFFVFMEDFRVTYKEEHPKNKSVAAVGKAGGEKWKSLS 78

  Fly   318 PEVKQKYESMAERDKARYEREMTEYKTSGKIAMSAPSMQASMQAQAQKAAL 368
            ...|..|.:.|::.|..||:.|..|  :.|:.::...|: ::.:|.|:..:
plant    79 DSEKAPYVAKADKRKVEYEKNMKAY--NKKLVIALRKMR-NLTSQFQRLTM 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dsp1NP_001138203.1 HMG-box 182..252 CDD:294061
HMGB-UBF_HMG-box 275..339 CDD:238686 23/64 (36%)
HMGB3NP_001031075.1 HMGB-UBF_HMG-box 35..101 CDD:238686 23/65 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000133
OrthoInspector 1 1.000 - - otm3305
orthoMCL 1 0.900 - - OOG6_100324
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X111
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.710

Return to query results.
Submit another query.