DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dsp1 and Tfam

DIOPT Version :9

Sequence 1:NP_001138203.1 Gene:Dsp1 / 117294 FlyBaseID:FBgn0278608 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_112616.2 Gene:Tfam / 83474 RGDID:620682 Length:244 Species:Rattus norvegicus


Alignment Length:176 Identity:48/176 - (27%)
Similarity:81/176 - (46%) Gaps:21/176 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 PRGRMTAYAYFVQTCREEHKKKHPDETVIFAEFSRKCAERWKTMVDKEKKRFHEMAEKDKQRYEA 247
            |:..|::|..|......:.|.||||..|  :|..||.|..|:.:.:.|||.:....:.:.:.|:.
  Rat    49 PKKPMSSYLRFSTEQLPKFKAKHPDAKV--SELIRKIAAMWRELPEAEKKVYEADFKAEWKVYKE 111

  Fly   248 EMQNY---VPP-------KGAVVGRGKKRKQIKDP-----NAPKRSLSAFFWFCNDERNKVKALN 297
            .:..|   :.|       |.|...|.||:.|||..     ..|||..||:..:.::...:.|   
  Rat   112 AVSKYKEQLTPSQLMGLEKEARQKRLKKKAQIKRRELILLGKPKRPRSAYNIYVSESFQEAK--- 173

  Fly   298 PEFGVGDIAKELGRKWSDVDPEVKQKYESMAERDKARYEREMTEYK 343
            .|...|.: |.:.:.|.::..:.||.|..:|:.|:.||:.||..::
  Rat   174 DESAQGKL-KLVNQAWKNLSHDEKQAYIQLAKDDRIRYDNEMKSWE 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dsp1NP_001138203.1 HMG-box 182..252 CDD:294061 19/68 (28%)
HMGB-UBF_HMG-box 275..339 CDD:238686 17/63 (27%)
TfamNP_112616.2 NHP6B <46..215 CDD:227935 47/171 (27%)
HMG_box 49..116 CDD:395407 19/68 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 221..244
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48112
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.