DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dsp1 and HMGB5

DIOPT Version :9

Sequence 1:NP_001138203.1 Gene:Dsp1 / 117294 FlyBaseID:FBgn0278608 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001329802.1 Gene:HMGB5 / 829709 AraportID:AT4G35570 Length:125 Species:Arabidopsis thaliana


Alignment Length:95 Identity:31/95 - (32%)
Similarity:48/95 - (50%) Gaps:10/95 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   262 RGKK-RKQIKDPNAPKRSLSAFFWFCNDERNKVKALNPE-FGVGDIAKELGRKWSDVDPEVKQKY 324
            ||.| .|:.||||.||:..|.||.|.:|.|.:....||: ..||::.:..|:||..:..|.:..:
plant    20 RGNKVGKKTKDPNRPKKPPSPFFVFLDDFRKEFNLANPDNKSVGNVGRAAGKKWKTMTEEERAPF 84

  Fly   325 ESMAERDKARYEREMTEY--------KTSG 346
            .:.::..|..|...|.:|        ||:|
plant    85 VAKSQSKKTEYAVTMQQYNMELANGNKTTG 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dsp1NP_001138203.1 HMG-box 182..252 CDD:294061
HMGB-UBF_HMG-box 275..339 CDD:238686 18/64 (28%)
HMGB5NP_001329802.1 HMGB-UBF_HMG-box 34..100 CDD:238686 18/65 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000133
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100324
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.710

Return to query results.
Submit another query.