DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dsp1 and 3xHMG-box2

DIOPT Version :9

Sequence 1:NP_001138203.1 Gene:Dsp1 / 117294 FlyBaseID:FBgn0278608 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_194111.1 Gene:3xHMG-box2 / 828480 AraportID:AT4G23800 Length:456 Species:Arabidopsis thaliana


Alignment Length:417 Identity:75/417 - (17%)
Similarity:149/417 - (35%) Gaps:115/417 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 QQQLAAQQQQQVQQQQLQQHQVVVQ-QNQQQAHQNSSNTTAGVGTQQLF---------------- 66
            :.::..:::::::.:..:|.::.|: :..|:..:...|.|...|...|.                
plant    72 KDEILRKKEEELETRDAEQEKLKVELKKLQKMKEFKPNMTFACGQSSLTQAEQEKANKKKKKDCP 136

  Fly    67 -TYKMASSF-------------PNPATTMAQVVATSNAAGTTGYDYRLNMAQAAAAAAVPGSQWW 117
             |.:.:||:             .||.   |....|||                     :.|::|.
plant   137 ETKRPSSSYVLWCKDQWTEVKKENPE---ADFKETSN---------------------ILGAKWK 177

  Fly   118 YSAA-------NQGQVDANTAAQLQHQQQQQQQQQQQQQQQHQQQQQMQQQQQQQNVINSA---- 171
            ..:|       .:.||:.....|:..:::::::..:..:...:|:..|:...|..|.:..|    
plant   178 SLSAEDKKPYEERYQVEKEAYLQVIAKEKREKEAMKLLEDDQKQRTAMELLDQYLNFVQEAEQDN 242

  Fly   172 -SPMSRVKADAKPRGRMTAYAYFVQ----TCREEHKKKHPDETVIFAEFSRKCAERWKTMVDKEK 231
             ....:.|...||:..::|:..:..    ..|||:|.        ..|.::...|.||.:.||:|
plant   243 KKKNKKEKDPLKPKHPVSAFLVYANERRAALREENKS--------VVEVAKITGEEWKNLSDKKK 299

  Fly   232 KRFHEMAEKDKQRYEAEMQNYVPPKGAVV------------------------------------ 260
            ..:.::|:|:|:.|...|:.|...|....                                    
plant   300 APYEKVAKKNKETYLQAMEEYKRTKEEEALSQKKEEEELLKLHKQEALQMLKKKEKTDNLIKKEK 364

  Fly   261 GRGKKRKQIKDPNAPKRSLSAFFWFCNDERNKVKALNPEFGVGDIAKELGRKWSDVDPEVKQKYE 325
            ...||:.:..|||.||:..|::|.|..|||.|:....|......:...:..||.::..|.||.|.
plant   365 ATKKKKNENVDPNKPKKPASSYFLFSKDERKKLTEERPGTNNATVTALISLKWKELSEEEKQVYN 429

  Fly   326 SMAERDKARYEREMTEYKTSGKIAMSA 352
            ..|.:....|::|:..|........|:
plant   430 GKAAKLMEAYKKEVEAYNKKSAATTSS 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dsp1NP_001138203.1 HMG-box 182..252 CDD:294061 19/73 (26%)
HMGB-UBF_HMG-box 275..339 CDD:238686 18/63 (29%)
3xHMG-box2NP_194111.1 PTZ00121 <2..454 CDD:173412 74/413 (18%)
HMGB-UBF_HMG-box 139..203 CDD:238686 14/87 (16%)
HMG-box 255..320 CDD:381793 18/72 (25%)
HMGB-UBF_HMG-box 379..444 CDD:238686 19/64 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 81 1.000 Inparanoid score I2367
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000133
OrthoInspector 1 1.000 - - otm3305
orthoMCL 1 0.900 - - OOG6_100324
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X111
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.720

Return to query results.
Submit another query.