DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dsp1 and UBTF

DIOPT Version :9

Sequence 1:NP_001138203.1 Gene:Dsp1 / 117294 FlyBaseID:FBgn0278608 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_016880484.1 Gene:UBTF / 7343 HGNCID:12511 Length:781 Species:Homo sapiens


Alignment Length:327 Identity:61/327 - (18%)
Similarity:127/327 - (38%) Gaps:70/327 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 GSQWWYSAANQGQVDANTAAQLQHQQQQQQQQQQQQQQQHQQQQ---QMQQQQQQQNVINSASPM 174
            |.||       .|:......:..|:..:|:::.::..:.:.|:.   .:.::...::.:..|...
Human   231 GKQW-------SQLSDKKRLKWIHKALEQRKEYEEIMRDYIQKHPELNISEEGITKSTLTKAERQ 288

  Fly   175 SRVKADAKP-RGRMTAYAYFVQTCREEHKKKHPDETVIFAEFSRKCAERWKTMVDKEKKRFHEMA 238
            .:.|.|.:| :....:|:.:........|.....|.::.      |:::||.:..|||..:|:..
Human   289 LKDKFDGRPTKPPPNSYSLYCAELMANMKDVPSTERMVL------CSQQWKLLSQKEKDAYHKKC 347

  Fly   239 EKDKQRYEAEMQNYV-----PPKGAVVGRGK----KRKQIKDP--------------NAPKRSLS 280
            ::.|:.||.|:..::     ..:..|:|..|    .:||...|              ..|||.:|
Human   348 DQKKKDYEVELLRFLESLPEEEQQRVLGEEKMLNINKKQATSPASKKPAQEGGKGGSEKPKRPVS 412

  Fly   281 AFFWFCNDERNKVKALNPEFGVGDIAKELGRKWSDVDPEVKQKYESMAERDKARYERE------- 338
            |.|.|..::|.:::...||....::.:.|.|.|:|:..:.|.||::.....||:.||:       
Human   413 AMFIFSEEKRRQLQEERPELSESELTRLLARMWNDLSEKKKAKYKAREAALKAQSERKPGGEREE 477

  Fly   339 -----------------------MTEYKTSGKIAMSAPSMQASMQAQAQKAALLAAAAQQQHQQL 380
                                   :..:|.....|:.|..|..:...:.:|...:..||:.|.:..
Human   478 RGKLPESPKRAEEIWQQSVIGDYLARFKNDRVKALKAMEMTWNNMEKKEKLMWIKKAAEDQKRYE 542

  Fly   381 EE 382
            .|
Human   543 RE 544

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dsp1NP_001138203.1 HMG-box 182..252 CDD:294061 15/70 (21%)
HMGB-UBF_HMG-box 275..339 CDD:238686 21/93 (23%)
UBTFXP_016880484.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.